KEGG   Bacillus cereus ATCC 10987: BCE_1362Help
Entry
BCE_1362          CDS       T00162                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCE_1362 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_1362 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCE_1362 (trpA)
Enzymes [BR:bca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCE_1362 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1365506..1366282
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKEQFIENCIEAGV
DGIIVPDLPYEEQDIIAPLLRTANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMITICDGVVVGSKVIELLENE
KREEICELIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcatttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaagttaaaagaaagaattcgttttctagatgaa
gcaggagcaagcatcgttgaaattggtatcccattttcagatccagttgcagatggccca
acaattcaaagagcagggaaacgagcactagatagcggtgtaacagtaaaaggcattttt
caagcattaatagaggtaaggaaagaagtacaaattccgtttgtacttatgacatattta
aatccagtactcgcattcggaaaagaacaattcatcgaaaattgtatagaagcaggggtg
gacggtattatcgttccagatttaccgtatgaagaacaagacattattgcaccgcttctc
cgaactgcaaatatcgctttaatcccactcgttaccgttacaagcccaattgagcgaatc
gagaaaattacgagtgaatcagaagggttcgtctacgccgttacagtagcgggcgtaaca
ggcgtacgtcaaaattttaaagaggagattcatagttatttagaaaaagtaaaatcacat
acgcatttaccggtagtggcagggttcggtatttcaacgaaggaacatgtagaagagatg
attacaatatgtgacggagttgtcgttggaagtaaagtgattgagctgttagaaaatgaa
aaacgagaagaaatatgtgaattaatacaggcaacaaaacaaaaagaagaggcataa

DBGET integrated database retrieval system