KEGG   Bacillus cereus ATCC 10987: BCE_1379Help
Entry
BCE_1379          CDS       T00162                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00020  Citrate cycle (TCA cycle)
bca00310  Lysine degradation
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
Module
bca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCE_1379 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BCE_1379 (odhB)
Enzymes [BR:bca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCE_1379 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1
Motif
Other DBs
NCBI-ProteinID: AAS40308
UniProt: Q73BN9
Position
complement(1381985..1383259)
Genome map
AA seq 424 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETAEAPKAEAPKAAAPSAEQTATL
QGLPNTNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSP
APAPVAKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKD
AFEKKHDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVP
VVRDANQLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQ
VGILGMHKIQVRPVAIDAERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSL
LLEG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgctgagcaaccaaaacaagaaacagctgaa
gcaccaaaagctgaagcaccaaaagctgcggcaccaagtgctgaacaaactgcaacttta
caaggtttaccaaatacaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgt
gaattaggaatcgacttaaacgacgtacgtagcacagatccacttggacgtgtgagacca
cacgatgtacaagctcatgctgcagcaccaaaagaagcaccagctgctccaaaaagtcca
gctcctgctccagttgcaaaaactgaatttgaaaaaccagttgagcgcgtgaaaatgtcc
cgccgccgtcaaacaattgcaaaacgccttgtagaagttcaacaaacatctgcaatgtta
acaacatttaacgaagttgatatgactgcaatcatggaattacgtaaagagcgtaaagac
gctttcgagaaaaaacatgatgtacgtcttggtttcatgtcattcttcacaaaagcagtt
gttgcagcattaaaacaattcccattattaaatgctgaaattcaaggtgacgagcttatc
attaaaaaattctatgatatcggtattgcagtagcagctccagatggattagttgttcca
gttgtacgcgatgcgaaccaattaaacttcgctgaaatcgaaagcgaaattcgtgaatta
ggtaaaaaagcacgtgataacaaactttcattaaaagaactacaaggtggtacatttaca
attacaaacgggggcgtgttcggttctctaatgtcaacaccgatcctaaacagcccacaa
gttggtattttaggaatgcacaaaatccaagtacgtcctgttgccattgatgcagaacgt
atggaaaaccgtccaatgatgtacatcgctttatcttacgatcaccgtatcgttgatggt
aaagaagcagttagcttccttgttgctgttaaagatatgcttgaagatccaaaatcatta
ttattagaaggttga

DBGET integrated database retrieval system