KEGG   Bacillus cereus ATCC 10987: BCE_1379Help
Entry
BCE_1379          CDS       T00162                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_1379 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCE_1379 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BCE_1379 (odhB)
Enzymes [BR:bca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCE_1379 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1381985..1383259)
Genome map
AA seq 424 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETAEAPKAEAPKAAAPSAEQTATL
QGLPNTNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSP
APAPVAKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKD
AFEKKHDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVP
VVRDANQLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQ
VGILGMHKIQVRPVAIDAERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSL
LLEG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgctgagcaaccaaaacaagaaacagctgaa
gcaccaaaagctgaagcaccaaaagctgcggcaccaagtgctgaacaaactgcaacttta
caaggtttaccaaatacaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgt
gaattaggaatcgacttaaacgacgtacgtagcacagatccacttggacgtgtgagacca
cacgatgtacaagctcatgctgcagcaccaaaagaagcaccagctgctccaaaaagtcca
gctcctgctccagttgcaaaaactgaatttgaaaaaccagttgagcgcgtgaaaatgtcc
cgccgccgtcaaacaattgcaaaacgccttgtagaagttcaacaaacatctgcaatgtta
acaacatttaacgaagttgatatgactgcaatcatggaattacgtaaagagcgtaaagac
gctttcgagaaaaaacatgatgtacgtcttggtttcatgtcattcttcacaaaagcagtt
gttgcagcattaaaacaattcccattattaaatgctgaaattcaaggtgacgagcttatc
attaaaaaattctatgatatcggtattgcagtagcagctccagatggattagttgttcca
gttgtacgcgatgcgaaccaattaaacttcgctgaaatcgaaagcgaaattcgtgaatta
ggtaaaaaagcacgtgataacaaactttcattaaaagaactacaaggtggtacatttaca
attacaaacgggggcgtgttcggttctctaatgtcaacaccgatcctaaacagcccacaa
gttggtattttaggaatgcacaaaatccaagtacgtcctgttgccattgatgcagaacgt
atggaaaaccgtccaatgatgtacatcgctttatcttacgatcaccgtatcgttgatggt
aaagaagcagttagcttccttgttgctgttaaagatatgcttgaagatccaaaatcatta
ttattagaaggttga

DBGET integrated database retrieval system