KEGG   Bacillus cereus ATCC 10987: BCE_1908Help
Entry
BCE_1908          CDS       T00162                                 

Definition
glucokinase, putative
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_1908
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_1908
   00052 Galactose metabolism
    BCE_1908
   00500 Starch and sucrose metabolism
    BCE_1908
   00520 Amino sugar and nucleotide sugar metabolism
    BCE_1908
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCE_1908
   00524 Butirosin and neomycin biosynthesis
    BCE_1908
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCE_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1840934..1841875
Genome map
AA seq 313 aa AA seqDB search
MGKYVACFDIGGTFIKYAMIDEQGIVHEQGKIKTPVQSQKKEILYRICEVIYEFEKSYKI
HSVGVSSCGIIDNIKGEVLYSANISGYSGTKIADYIYSETGYVASIENDVRSACLGEMWK
GVGQGKEHIVLITLGTGIGSGIITNGKMLQGVKGLAGELGHMIIVHNGEKCSCGGEGCYE
RYASTSALIRQYKEASKIQGLEIGTITGEEIIERMYRGERLAKDVYEQFLQYVVAGLVNI
TYIFNPELIIIGGGITEQGEPFLKQIQERFHDKIMDIYQNKVEIALASLHNDAGVYGACY
VALNQCEEKSMNI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtacgttgcttgttttgatattggaggaacttttataaaatatgcaatgatt
gatgaacaaggaatagtacatgaacaagggaaaataaaaacaccagtacaaagtcaaaag
aaagaaattttgtatcgcatttgtgaagtaatatatgagtttgaaaagagctataaaatt
cattctgtaggtgtatcatcgtgtgggattatcgataatatcaagggggaagttctgtat
tctgccaatatttcgggatatagcggtacaaaaatagcagattacatttatagtgagaca
gggtatgtggcgagtattgaaaatgatgttcgttcagcttgtctcggtgaaatgtggaaa
ggagtagggcaggggaaagaacatattgttttaatcacacttggaaccgggattggtagt
ggaatcattacaaatggcaaaatgcttcagggagtgaaaggattagcaggagagcttggt
catatgataattgttcataatggagaaaaatgtagttgtggtggagagggatgttatgag
agatatgcatcgacttcggcattgattcgtcagtataaagaagcatcaaaaattcaaggg
ctagagataggcacaatcacaggtgaagaaattatagaacgtatgtacagaggagaacga
ttggcaaaggatgtatatgagcagtttctacagtatgttgttgctggtttagtaaatatt
acttatatatttaaccccgaattaattattattgggggaggtattacagagcaaggtgaa
ccatttttgaaacaaattcaagaaaggttccatgacaaaataatggatatctatcaaaat
aaggtggaaatcgctttagcatcattacataatgatgctggtgtatatggagcttgttat
gtagcgttgaatcaatgtgaggaaaaatcaatgaatatataa

DBGET integrated database retrieval system