KEGG   Bacillus cereus ATCC 10987: BCE_1908Help
Entry
BCE_1908          CDS       T00162                                 

Definition
(GenBank) glucokinase, putative
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00052  Galactose metabolism
bca00500  Starch and sucrose metabolism
bca00520  Amino sugar and nucleotide sugar metabolism
bca00521  Streptomycin biosynthesis
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
Module
bca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_1908
   00052 Galactose metabolism
    BCE_1908
   00500 Starch and sucrose metabolism
    BCE_1908
   00520 Amino sugar and nucleotide sugar metabolism
    BCE_1908
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCE_1908
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCE_1908
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCE_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Pox_TAA1
Motif
Other DBs
NCBI-ProteinID: AAS40832
UniProt: Q73A74
Position
1840934..1841875
Genome map
AA seq 313 aa AA seqDB search
MGKYVACFDIGGTFIKYAMIDEQGIVHEQGKIKTPVQSQKKEILYRICEVIYEFEKSYKI
HSVGVSSCGIIDNIKGEVLYSANISGYSGTKIADYIYSETGYVASIENDVRSACLGEMWK
GVGQGKEHIVLITLGTGIGSGIITNGKMLQGVKGLAGELGHMIIVHNGEKCSCGGEGCYE
RYASTSALIRQYKEASKIQGLEIGTITGEEIIERMYRGERLAKDVYEQFLQYVVAGLVNI
TYIFNPELIIIGGGITEQGEPFLKQIQERFHDKIMDIYQNKVEIALASLHNDAGVYGACY
VALNQCEEKSMNI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtacgttgcttgttttgatattggaggaacttttataaaatatgcaatgatt
gatgaacaaggaatagtacatgaacaagggaaaataaaaacaccagtacaaagtcaaaag
aaagaaattttgtatcgcatttgtgaagtaatatatgagtttgaaaagagctataaaatt
cattctgtaggtgtatcatcgtgtgggattatcgataatatcaagggggaagttctgtat
tctgccaatatttcgggatatagcggtacaaaaatagcagattacatttatagtgagaca
gggtatgtggcgagtattgaaaatgatgttcgttcagcttgtctcggtgaaatgtggaaa
ggagtagggcaggggaaagaacatattgttttaatcacacttggaaccgggattggtagt
ggaatcattacaaatggcaaaatgcttcagggagtgaaaggattagcaggagagcttggt
catatgataattgttcataatggagaaaaatgtagttgtggtggagagggatgttatgag
agatatgcatcgacttcggcattgattcgtcagtataaagaagcatcaaaaattcaaggg
ctagagataggcacaatcacaggtgaagaaattatagaacgtatgtacagaggagaacga
ttggcaaaggatgtatatgagcagtttctacagtatgttgttgctggtttagtaaatatt
acttatatatttaaccccgaattaattattattgggggaggtattacagagcaaggtgaa
ccatttttgaaacaaattcaagaaaggttccatgacaaaataatggatatctatcaaaat
aaggtggaaatcgctttagcatcattacataatgatgctggtgtatatggagcttgttat
gtagcgttgaatcaatgtgaggaaaaatcaatgaatatataa

DBGET integrated database retrieval system