KEGG   Bacillus cereus ATCC 10987: BCE_2052Help
Entry
BCE_2052          CDS       T00162                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCE_2052 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_2052 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCE_2052 (thrC)
Enzymes [BR:bca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCE_2052 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1982938..1983996
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggattattaaaacagtatgcttcttatttaccagtaaatgaaaatacacct
gatgtgagcttaatggaagggaatacaccgcttatcccgttattaaatatatcaaaacaa
ttaggaattcagttatacggtaagtatgaaggagcgaatccgacaggttcttttaaagat
cgtggtatggtaatggcagttgcgaaggcgaaagaagaaggttcagaggctattatttgt
gcatcgacaggtaatacatcagcatcggccgcagcatacgcggcacgtcttggaatgaaa
tgtattatcgtaatcccagaagggaaaattgcacatgggaaattagcgcaagcagttgcc
tatggtgctgaaattatttcaatagaaggaaattttgatgatgcactaaaggctgtaaga
aatattgctgcagaagagccaatcacattagttaactcggtaaatccttatcgaattgaa
gggcaaaaaacagcagcatttgaaatttgtgaccaattgcaaagtgcaccagatgtttta
gcgattcctgttgggaatgccggaaatattacagcgtactggaagggtttctgtgaatat
gagaaagaaaarggatataagaagccaagaattcatggatttgaagcggaaggagcagct
gctattgtaaaagggcatgtaattgacgagccagaaacaattgcaacagcgatacgcatc
ggtaacccagcaagttggtcatatgcagtagaggctgctgagcagtctcacggtgaaata
gatatggtatcagatgaagaaattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcgaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagttgttgcagttttaactggaaacggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system