KEGG   Bacillus cereus ATCC 10987: BCE_2156Help
Entry
BCE_2156          CDS       T00162                                 

Definition
acetaldehyde dehydrogenase, putative
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCE_2156
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE_2156
   00650 Butanoate metabolism
    BCE_2156
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BCE_2156
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE_2156
   00622 Xylene degradation
    BCE_2156
   00621 Dioxin degradation
    BCE_2156
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCE_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2069487..2070386
Genome map
AA seq 299 aa AA seqDB search
MKKVKAAIIGSGNIGTDLMYKLKNSKVIELNAMIGIDSESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHSYHAKILEELGKIVIDLTPAAYGPFVCPAIRNNDFLDKQN
VNMITCGGQATIPIVHAINEVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEI
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPGYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIVSEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtaaaggcggctataattggatcaggtaatattggtacggatttaatgtat
aaattaaaaaatagtaaagttatagagctaaatgccatgattggaatagattccgaatcg
gatggtttaaagagagcgaaagaagccggatatgaggtttttgataatggaatacaagca
attattgataatccgagtttagctgatattgtatttgacgcaacttcagctaaagcacat
agttatcatgcgaaaatattagaagagcttgggaaaatagtaattgacttaactccggct
gcatatgggccatttgtttgtcctgctattcgaaataatgattttttagataagcaaaac
gttaatatgattacgtgcgggggacaagcaacaattccgattgttcatgctattaatgag
gtagcaaatgttacatatgcagagatagttgctacaatttccagtttaagtgcaggtcca
ggtacaagggcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaaatt
ggtggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataagatggttgaacgggttaggacgtatgttcctggttactctttgaaacaagag
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcgtttcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system