KEGG   Bacillus cereus ATCC 10987: BCE_2156Help
Entry
BCE_2156          CDS       T00162                                 

Definition
(GenBank) acetaldehyde dehydrogenase, putative
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00360  Phenylalanine metabolism
bca00362  Benzoate degradation
bca00620  Pyruvate metabolism
bca00621  Dioxin degradation
bca00622  Xylene degradation
bca00650  Butanoate metabolism
bca01100  Metabolic pathways
bca01120  Microbial metabolism in diverse environments
bca01220  Degradation of aromatic compounds
Module
bca_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE_2156
   00650 Butanoate metabolism
    BCE_2156
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BCE_2156
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE_2156
   00622 Xylene degradation
    BCE_2156
   00621 Dioxin degradation
    BCE_2156
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCE_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3 IlvN DapB_N F420_oxidored TrkA_N CoA_binding Fumerase_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AAS41077
UniProt: Q739I5
Position
2069487..2070386
Genome map
AA seq 299 aa AA seqDB search
MKKVKAAIIGSGNIGTDLMYKLKNSKVIELNAMIGIDSESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHSYHAKILEELGKIVIDLTPAAYGPFVCPAIRNNDFLDKQN
VNMITCGGQATIPIVHAINEVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEI
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPGYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIVSEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtaaaggcggctataattggatcaggtaatattggtacggatttaatgtat
aaattaaaaaatagtaaagttatagagctaaatgccatgattggaatagattccgaatcg
gatggtttaaagagagcgaaagaagccggatatgaggtttttgataatggaatacaagca
attattgataatccgagtttagctgatattgtatttgacgcaacttcagctaaagcacat
agttatcatgcgaaaatattagaagagcttgggaaaatagtaattgacttaactccggct
gcatatgggccatttgtttgtcctgctattcgaaataatgattttttagataagcaaaac
gttaatatgattacgtgcgggggacaagcaacaattccgattgttcatgctattaatgag
gtagcaaatgttacatatgcagagatagttgctacaatttccagtttaagtgcaggtcca
ggtacaagggcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaaatt
ggtggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataagatggttgaacgggttaggacgtatgttcctggttactctttgaaacaagag
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcgtttcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system