KEGG   Bacillus cereus ATCC 10987: BCE_2160Help
Entry
BCE_2160          CDS       T00162                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_2160
   01230 Biosynthesis of amino acids
    BCE_2160
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2160
  Energy metabolism
   00680 Methane metabolism
    BCE_2160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_2160
Enzymes [BR:bca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCE_2160
Exosome [BR:bca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCE_2160
  Exosomal proteins of melanoma cells
   BCE_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072525..2073115
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESKADILHVHEGRADFELTEKGRRQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEMDGE
QKTVHFINDTNHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccatggagaatctaaagcagatattttacatgtacatgaa
ggacgagctgactttgaattaacagaaaaaggaagaaggcaagtgcaaaggcttgtacag
aaagtgaaagcagattttccgccagatttcatttgggcaagtacattaaaacgtgctcgt
gaaacgggtgaaacattagcggaaggaattgggtgtccaattcaattagaagaggaatta
atggagttcaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgaccgatttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggaatcttttctaaaatcgtaacagagaatacgtatgaccgaattgccatt
gttgcacatggtggtgtaataaatagtctattacgtgcatttttcaaaatgcccatttca
atggattattattttaaaatgggagatacgggaataagcttaattgaaatggatggcgaa
caaaaaacggtacattttattaatgatacgaatcatttggatgggatgtag

DBGET integrated database retrieval system