KEGG   Bacillus cereus ATCC 10987: BCE_2202Help
Entry
BCE_2202          CDS       T00162                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BCE_2202 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCE_2202 (bsaA)
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BCE_2202 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2104017..2104502
Genome map
AA seq 161 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGNN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacgataacaggggaagaaaaatcgttaaaagat
tacgaaggaaaagcgcttcttattgtaaatgtagctagtaaatgcgggtttacaccacag
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccttgtaaccaattcggaggacaagaaccaggtacagaagcagatattacaagcttt
tgtgaattaaactacggtgtaaacttcccgatgtttgcaaaaattgatgtgaaaggtgat
aaagctcatccgctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacgggaaagtagtagggcgt
tttgcgccgcaaacgaagccggttgatttagaggttgagattgagaaggtacttgggaat
aactag

DBGET integrated database retrieval system