KEGG   Bacillus cereus ATCC 10987: BCE_2210Help
Entry
BCE_2210          CDS       T00162                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bca00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bca00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2112801..2114138
Genome map
AA seq 445 aa AA seqDB search
MAQSSTNKVSYFESVNKVLYEGKGSKNPLAFKYYNPEEIVGDKTMKEQLRFSIAYWHTFT
ADGTDPFGAATMQRAWDKYDGMDLAKARVEAAFQLFEKLNVPFFAFHDRDIAPEGSTLRE
TNKNLDVIVTMIKDYMKTSNVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYDTLLNTNLKLELDNLARFMQMSVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTISFLRQYGLENHFKLNLEANHATLAGHTFEHELRVARVQGFLGS
VDANQGNPLLGWDTDEFPTNLYSTTLAMYEILQNGGLGSGGLNFDAKVRRASFEEEDLVY
AHIAGMDAFARGLKVAHKLLEDRVFENIIDERYHSFRDGIGLEIVEGRANFHTLEQYALQ
NSIIKNQSGKQERLKAILNQYILEV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatctagtacaaataaagttagttattttgaaagcgtaaacaaagttttatac
gaaggtaaaggttctaaaaaccctttagcttttaaatactataatccggaagaaatagtt
ggcgataaaacaatgaaggagcaacttcgtttctctattgcttattggcacacatttaca
gcggatggtacagatccatttggtgctgctacaatgcaaagagcatgggataaatacgat
ggaatggatttagcgaaagctagagtggaagcagcctttcaactctttgaaaaattaaat
gttcctttctttgcatttcatgatcgagacattgcacctgaagggagcacgttgagagaa
acaaataaaaatttagatgtaatcgtaactatgattaaagattatatgaaaacaagcaat
gtaaaattgttatggaatacggctaatatgtttacaaatcctcgtttcgtccatggtgca
gctacctcttgtaacgcagatgtatttgcttatgcagctgcacaagtgaaaaagggactt
gaaactgccaaagagctaggtgcggaaaattatgtattctggggcggtcgtgaaggctat
gacacattactaaatacaaatctgaaattagagttggataacctagctagatttatgcaa
atgtccgtagattatgcaaaagaaattggatatacagggcaattcttaattgaacctaaa
cccaaagaaccaacaacacatcaatatgatacagatgctgctacgactatttcattcttg
agacaatatgggctagaaaatcattttaaattaaaccttgaagctaatcatgcaacttta
gctggccatacttttgaacatgaattacgagtagcgagggtgcaaggctttttaggatca
gtcgatgcaaaccaaggtaaccctcttttaggatgggatacagatgaatttccaacgaat
ctatattctacaactttagcaatgtatgaaattcttcaaaatggcggactaggtagtggt
ggattaaactttgatgcaaaagtacgtagagcatcctttgaagaagaagatttagtatat
gctcatatcgctggaatggatgcatttgctagagggctaaaagtagctcataaattatta
gaagatcgtgtatttgaaaacattattgacgaacgttaccacagttttagagacggtatt
ggtcttgaaattgttgaaggaagagcaaatttccatacattagagcagtatgcattacaa
aactcaattattaagaaccaatcaggaaaacaagaacgattaaaggcaatcttaaatcaa
tatatcttagaagtttaa

DBGET integrated database retrieval system