KEGG   Bacillus cereus ATCC 10987: BCE_2212Help
Entry
BCE_2212          CDS       T00162                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bca00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bca00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2115879..2116922
Genome map
AA seq 347 aa AA seqDB search
MNVKEEIFGEVDGREVKSFTMMNDQGMKITCIDLGCTITRIDVPDKKGNLENIVLGFDCL
EEYLKYSPYFGAVIGRVAGRIYPSSFNLDDVTYHLPNNEGETHLHGGPNGFHQVIWESSI
SQSPNEINITFTYMSPDGEGGYPGNLKVSVVYTLTNNNELVITYYGISDKNTLLNVTNHT
YFNLSGNLKKDILQHELTIKSDQFLELNRSLLPTSKLINVENTPFDFRSGKRIICGVKSE
HPQNKIVGRGYDHPFLLGENKQQICLIDHSNGRKMIIKTDEPCVVLYTGNMLGDHFQIRG
VPCRKYLGLCLETQRPPNSIHNREFASILLEKDKEYHSKTCFSFTLA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaagaggagatttttggtgaggtagatggtagagaagtaaaatcatttacc
atgatgaatgatcaaggaatgaaaatcacttgtattgatttaggatgtacgattactaga
attgatgtaccagataagaaaggtaatttagaaaatatcgttttaggctttgattgttta
gaagaatatctaaaatattcaccatactttggtgcggtaattggtcgagttgcagggagg
atatatccatcaagtttcaatctggatgatgtaacataccacctaccaaataatgaagga
gaaactcatttacacggagggcctaacggttttcatcaagttatttgggaatcttctatt
agtcaaagtcctaatgaaataaatattacatttacctatatgagcccagacggtgaagga
ggatatcctggaaatcttaaagtgagtgtagtttataccctaactaataataatgaatta
gtcattacttattatggaatttcagataagaacaccttgttgaatgtgacaaatcatact
tactttaatttaagtgggaatctaaaaaaagatatcttgcagcatgaattaactataaaa
agtgatcaattcttagaacttaatcgttcattacttcccacgagtaagttaattaacgtc
gaaaatacaccttttgattttagaagtggaaaaaggatcatttgtggagtgaaatcggaa
cacccacaaaataaaattgttggtagaggatatgatcacccatttttattaggtgagaat
aagcagcaaatttgtttgattgatcattctaatggaagaaaaatgatcataaaaacggat
gaaccatgtgttgttttatatacaggaaatatgttgggagatcactttcaaattaggggt
gttccttgtcgaaagtatcttggtctatgccttgaaacacaacgtccacccaactccatt
cataatagggaatttgcttctattttattagaaaaagataaagagtatcattctaaaacc
tgttttagttttacattagcgtag

DBGET integrated database retrieval system