KEGG   Bacillus cereus ATCC 10987: BCE_2252Help
Entry
BCE_2252          CDS       T00162                                 

Definition
alcohol dehydrogenase, iron-containing (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bca01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bca00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bca00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bca00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bca00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bca00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2159735..2160937
Genome map
AA seq 400 aa AA seqDB search
MQEVAEFRMPKSVLYGRNSLEKLGEQSKKFGKRAFIVTDTIMENLGYVESCIQQLNTKGI
TVITYNKVNAEPTNIHVLEALTICKEEKCDFIIGLGGGSCIDAAKAVAVLYTNGGEVEDY
VQKDMEIDNDPLPLIAIPTTSGTGSEVTSVAVITNKRTDVKMMMKHPSFTPQVAIIDPIL
TRSVPPHITAATGIDALCHAVEAYISKVSQSLTDVLALSAIESIMKYLRIAYEDGENMEA
REAMMIASLQAVIAFSNASVTLVHGMSRPVGALFHVPHGISNAILLPTVLEYTKVSAVKR
LAEIGRCLNKDMYSYCDEEVADYTLGEIKKLCFDLRIPNLKEYGIGEVEFEKAISKMASD
AIESGSPANNPRVPSYDEIKQLYRECFHYRYEDSIKTLEF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaagttgctgaatttcgtatgccgaagtctgtattatatggaagaaattcgctt
gaaaaactgggggaacaatccaagaagtttggaaaaagagcttttatagtaactgataca
attatggagaatttaggatatgttgagagttgtatacaacaattaaatacaaaaggtatt
accgttattacatataataaagtaaatgctgagcctacaaatatacatgtgttagaggcg
ttaactatttgtaaagaggaaaagtgtgattttattatcggtcttggtggtggaagttgt
attgatgcagcaaaagcagttgcggtgttatatacaaatggcggagaagtagaagattat
gtccaaaaggatatggaaatagacaatgatccgctaccgctcattgcaattccaacaact
tcgggtactgggtcagaagtaacaagtgtagcagtaattacgaataaacgaacagatgta
aaaatgatgatgaaacatccgagttttaccccgcaagtagcgattattgatccgatttta
acacgttctgtaccacctcatattacagcagcaacagggatagatgcattatgtcatgca
gtcgaagcatatatttctaaagtttcacaatcacttacagatgtactcgctctttccgct
attgaaagtattatgaaatatttacgtattgcatatgaagatggagagaatatggaggca
agagaagcgatgatgattgcttccttacaagctgtaattgcattttcaaacgcatctgtt
acattagttcatggaatgtcaagaccagtaggagcgttatttcatgtaccacatggtata
tcaaatgcaatactattacctacagttttagagtatacaaaagtgagtgcagtaaaaaga
ctagcagaaattggacgctgtttaaataaagatatgtattcctattgtgatgaagaagta
gccgattacacgctcggggaaataaaaaaactttgctttgatcttcgtattccaaattta
aaagaatacggaattggtgaggttgaatttgaaaaagctatttctaaaatggcatcagat
gcaattgaaagtggaagtccagcaaataatccacgagtaccatcctatgatgaaattaaa
cagttgtatcgagaatgttttcattatcgatatgaagattctataaaaacattagagttt
taa

DBGET integrated database retrieval system