KEGG   Bacillus cereus ATCC 10987: BCE_2252Help
Entry
BCE_2252          CDS       T00162                                 

Definition
alcohol dehydrogenase, iron-containing (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCE_2252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2252
  Lipid metabolism
   00071 Fatty acid degradation
    BCE_2252
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCE_2252
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCE_2252
   00626 Naphthalene degradation
    BCE_2252
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCE_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2159735..2160937
Genome map
AA seq 400 aa AA seqDB search
MQEVAEFRMPKSVLYGRNSLEKLGEQSKKFGKRAFIVTDTIMENLGYVESCIQQLNTKGI
TVITYNKVNAEPTNIHVLEALTICKEEKCDFIIGLGGGSCIDAAKAVAVLYTNGGEVEDY
VQKDMEIDNDPLPLIAIPTTSGTGSEVTSVAVITNKRTDVKMMMKHPSFTPQVAIIDPIL
TRSVPPHITAATGIDALCHAVEAYISKVSQSLTDVLALSAIESIMKYLRIAYEDGENMEA
REAMMIASLQAVIAFSNASVTLVHGMSRPVGALFHVPHGISNAILLPTVLEYTKVSAVKR
LAEIGRCLNKDMYSYCDEEVADYTLGEIKKLCFDLRIPNLKEYGIGEVEFEKAISKMASD
AIESGSPANNPRVPSYDEIKQLYRECFHYRYEDSIKTLEF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaagttgctgaatttcgtatgccgaagtctgtattatatggaagaaattcgctt
gaaaaactgggggaacaatccaagaagtttggaaaaagagcttttatagtaactgataca
attatggagaatttaggatatgttgagagttgtatacaacaattaaatacaaaaggtatt
accgttattacatataataaagtaaatgctgagcctacaaatatacatgtgttagaggcg
ttaactatttgtaaagaggaaaagtgtgattttattatcggtcttggtggtggaagttgt
attgatgcagcaaaagcagttgcggtgttatatacaaatggcggagaagtagaagattat
gtccaaaaggatatggaaatagacaatgatccgctaccgctcattgcaattccaacaact
tcgggtactgggtcagaagtaacaagtgtagcagtaattacgaataaacgaacagatgta
aaaatgatgatgaaacatccgagttttaccccgcaagtagcgattattgatccgatttta
acacgttctgtaccacctcatattacagcagcaacagggatagatgcattatgtcatgca
gtcgaagcatatatttctaaagtttcacaatcacttacagatgtactcgctctttccgct
attgaaagtattatgaaatatttacgtattgcatatgaagatggagagaatatggaggca
agagaagcgatgatgattgcttccttacaagctgtaattgcattttcaaacgcatctgtt
acattagttcatggaatgtcaagaccagtaggagcgttatttcatgtaccacatggtata
tcaaatgcaatactattacctacagttttagagtatacaaaagtgagtgcagtaaaaaga
ctagcagaaattggacgctgtttaaataaagatatgtattcctattgtgatgaagaagta
gccgattacacgctcggggaaataaaaaaactttgctttgatcttcgtattccaaattta
aaagaatacggaattggtgaggttgaatttgaaaaagctatttctaaaatggcatcagat
gcaattgaaagtggaagtccagcaaataatccacgagtaccatcctatgatgaaattaaa
cagttgtatcgagaatgttttcattatcgatatgaagattctataaaaacattagagttt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system