KEGG   Bacillus cereus ATCC 10987: BCE_2280Help
Entry
BCE_2280          CDS       T00162                                 

Gene name
asnO
Definition
asparagine synthetase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCE_2280 (asnO)
Enzymes [BR:bca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCE_2280 (asnO)
Peptidases [BR:bca01002]
 Cysteine Peptidases
  Family C44
   BCE_2280 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2184664..2186481
Genome map
AA seq 605 aa AA seqDB search
MIFHRGPDDEGYFRDEHVQFGFRRLSIIDLEAGHQPLTYENDRYVIIFNGEIYNYVELRE
MLLEKGATFATQSDTEVIIALYAHMKEKCVDYLRGMFAFMIWDREEKKLFGARDHFGIKP
LYIAQQGDTTFFASEKKSIMHVMEDKGVNPTSLQHYFTYQYGPEPETLTIDVNKIEPGHY
FVKEIGKEMEIHRYWKPYFNASSATKEEHIQAIRDVLYDSVKVHMRSDVPVGSFLSGGID
SSIIASIAREMNPNLLTFSVGFEQRGFSEVDVAKETAEKLGVKNHNVFISAKEFMDEFPK
IIWHMDDPLADPAAVPLYFVAKEARKHVTVVLSGEGADELFGGYNIYREPNSLKMFSYIP
SPGKSVLKALSGALKEGFKGKSFLERGCTPIEERYYGNAKIFREEEKAELMKYYNESVNY
MDITKPLYNEIKDYDDVSKMQYIDMFTWLRGDILLKADKMTMANSLELRVPFLDKEVFDV
ASKIPTEFKIANGTTKAILREAARGIVPDHVLDRKKLGFPVPIRHWLKDEMHDWAINIIN
ESKTEHLIDKQYVLNLLEAHCADKGDYSRKIWTVLAFMVWHQIYVEHKYDTNKFHEETKR
AYSLV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgattttccaccgtggtccagatgacgaaggatattttcgtgatgagcatgtacaattt
ggcttccgccgtttaagtatcattgacttagaggcaggacatcagccgctaacttatgaa
aatgatcgatatgtaattatttttaatggtgaaatttacaactatgtagaattacgtgaa
atgttacttgaaaaaggtgcaacgtttgcaacgcaatctgatacagaagttatcattgca
ttgtatgcacatatgaaagaaaaatgtgtagactaccttcgtggtatgtttgcatttatg
atttgggatcgtgaagaaaagaaacttttcggtgcacgtgaccacttcggtattaaacct
ttatacatcgcacaacaaggtgatactacattcttcgcatctgagaagaaaagtattatg
catgtgatggaagataaaggcgttaacccaacgtcattacaacattattttacgtaccaa
tatggtccagagccagaaacattaacaattgatgttaataaaatcgaacctggtcattat
ttcgtaaaagaaatcggtaaagagatggaaatccatcgctactggaaaccttatttcaat
gcttcaagtgcaacgaaagaggagcatatccaagcaattcgtgatgtgttatatgattca
gtaaaagtgcatatgcgcagtgatgtaccagtaggttcattcttatctggtggtatcgat
tcatctatcatcgcttctatcgcaagagaaatgaatccaaatcttttaacattctctgtt
gggtttgagcaacgtggtttcagtgaagttgatgttgcgaaagaaactgctgagaaatta
ggcgttaaaaaccataacgtattcatttcagcgaaagagtttatggatgagttcccaaaa
atcatttggcatatggatgatcctttagcagatccagcagctgtaccgttgtacttcgtt
gctaaagaagcacgtaagcatgtaacagttgttctttcaggcgaaggtgcagacgagcta
tttggtggttataacatttatcgtgagccaaactcactgaaaatgttctcttacattcct
agcccaggtaagagcgttctaaaagcactaagtggtgctcttaaagaaggctttaaagga
aagagcttcctagagcgtggatgtacgccaattgaagagcgttactatggaaacgcgaaa
atcttccgtgaagaagagaaagctgaattaatgaagtattacaatgaaagtgttaactat
atggatatcacgaaaccattgtataacgaaattaaagattatgatgatgtaagcaaaatg
cagtacattgacatgttcacatggttacgcggtgacattttattaaaagctgataaaatg
acaatggcaaactcattagaacttcgtgtaccgttcttagataaagaagtattcgatgtt
gcatctaaaattccaactgaatttaagattgctaacggaactacgaaagctattttacgt
gaagcagcacgcggaatcgttccagatcacgtattagatcgtaaaaaacttggattccca
gtaccaattcgtcactggttaaaagacgaaatgcatgattgggctatcaatattataaac
gagagtaagacagagcatttaatcgacaaacagtatgtattaaacttactggaagcacat
tgtgcagataaaggcgattatagccgtaaaatttggactgtacttgcgtttatggtatgg
catcaaatttatgttgagcataaatacgatacgaataagttccacgaagaaacgaaacgt
gcgtatagcttagtttaa

DBGET integrated database retrieval system