KEGG   Bacillus cereus ATCC 10987: BCE_2520Help
Entry
BCE_2520          CDS       T00162                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_2520 (gpm)
   01230 Biosynthesis of amino acids
    BCE_2520 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2520 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCE_2520 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_2520 (gpm)
Enzymes [BR:bca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCE_2520 (gpm)
Exosome [BR:bca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCE_2520 (gpm)
  Exosomal proteins of melanoma cells
   BCE_2520 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2402814..2403551
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWIPVHKCWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGELPLTECLVDTEKRVLAYWHSEIAPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDDNLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggttggactgatgtagacttatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaatggatatacttttgatgttgcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggaccttgcatggatcccagtacat
aaatgttggaaactaaatgaaagacattacggtgcattgcaaggattgaataaagatgaa
acggcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcctaggtatgaaatgaatgatccaagatataaagca
cttaaaaaaggtgagcttccattgactgaatgtttagtggatacggagaaaagagtactt
gcttattggcattcagaaatcgcgccatcattaaaaagtggtgaaaaggtaattatttca
tcacacggtaatacgattcgttcgctagtgaaatacttagataacctttcaagtgatggt
gttgtttcattaaatattccaacgagtataccactcgtttatgaattagacgataattta
cgaccaattcgtcattattacttaagtatggacggagaagtaccagaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system