KEGG   Bacillus cereus ATCC 10987: BCE_2520Help
Entry
BCE_2520          CDS       T00162                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00260  Glycine, serine and threonine metabolism
bca00680  Methane metabolism
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
bca01230  Biosynthesis of amino acids
Module
bca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bca_M00002  Glycolysis, core module involving three-carbon compounds
bca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2520 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCE_2520 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_2520 (gpm)
Enzymes [BR:bca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCE_2520 (gpm)
Membrane trafficking [BR:bca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCE_2520 (gpm)
Exosome [BR:bca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCE_2520 (gpm)
  Exosomal proteins of melanoma cells
   BCE_2520 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAS41437
UniProt: Q737X5
Position
2402814..2403551
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWIPVHKCWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGELPLTECLVDTEKRVLAYWHSEIAPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDDNLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggttggactgatgtagacttatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaatggatatacttttgatgttgcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggaccttgcatggatcccagtacat
aaatgttggaaactaaatgaaagacattacggtgcattgcaaggattgaataaagatgaa
acggcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcctaggtatgaaatgaatgatccaagatataaagca
cttaaaaaaggtgagcttccattgactgaatgtttagtggatacggagaaaagagtactt
gcttattggcattcagaaatcgcgccatcattaaaaagtggtgaaaaggtaattatttca
tcacacggtaatacgattcgttcgctagtgaaatacttagataacctttcaagtgatggt
gttgtttcattaaatattccaacgagtataccactcgtttatgaattagacgataattta
cgaccaattcgtcattattacttaagtatggacggagaagtaccagaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system