KEGG   Bacillus cereus ATCC 10987: BCE_2604Help
Entry
BCE_2604          CDS       T00162                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family superfamily
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCE_2604
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_2604
  Lipid metabolism
   00071 Fatty acid degradation
    BCE_2604
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCE_2604
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCE_2604
   00626 Naphthalene degradation
    BCE_2604
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCE_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2480022..2480948
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKRLKWETREIKSIQNDEIIVKTIAGAISIGAELPQYKESDVSDTNPIYP
RKTGYESYGEVIQVGNKVTNLNIGDKVVSFYGHETIGIVKGDKVIRVPSYIKPKVALLSI
LSCDAAKGVLKLNMRQDEKVLITGMGVIGLLACYFLKYYVGVKHVDVVXPNKNRRDFAKN
FGAKNTYESEEQIIETYNYGFECSATNIGFHTLQKALNSNSEICILSDGNLEELTLTADF
YEKELRIIGSSDGYNYQQHADWFFSQIEQTPWIEEIFQHEIQYTGLIQCFEELSQGIITP
LKVFVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaacgtcttaagtgggaaacgcgcgaa
attaagtctatacagaatgatgaaattatcgttaaaacaattgcaggtgcaataagtatt
ggagcagagttaccacagtataaagaatcggatgtttcagatacaaatcctatttatcca
agaaaaactggatatgaaagttatggtgaagtgattcaagttggtaataaagtaacgaat
ttaaacataggcgataaagtagtttctttttatggacatgaaacgataggaatagttaag
ggggataaagtaattcgagttcctagttatataaaacctaaagtggcgttattatctatt
ctttcgtgtgatgctgctaaaggagtattaaaactaaatatgcgacaggatgaaaaagta
cttataactggaatgggagttattggtttactcgcttgttattttttaaaatactatgta
ggtgttaagcatgtagatgttgttgamcctaataaaaatagaagagattttgcaaagaat
tttggtgcgaaaaacacatatgaatcagaagaacaaataatagaaacatataattacggt
ttcgaatgttctgctacaaatatcggatttcatacattacaaaaagcacttaacagtaat
agtgaaatatgtatactttctgatgggaatttagaggaactaacattaaccgctgatttt
tatgagaaagaactgcggatcattggttcaagtgacggatataattatcaacaacatgca
gattggttttttagtcaaatagaacaaacaccatggatagaagagatttttcaacatgaa
atacaatatacaggactcattcaatgttttgaggaattaagtcaaggaataattacccct
ttaaaagtatttgtctcatatgaataa

DBGET integrated database retrieval system