KEGG   Bacillus cereus ATCC 10987: BCE_3038Help
Entry
BCE_3038          CDS       T00162                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bca00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bca00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bca02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2852938..2854599)
Genome map
AA seq 553 aa AA seqDB search
MFVLGLKMKKLLLVGTITLSMLCTESMMDDHTVEAKVKKVERQPKNVIIMVMDGTSSSAT
TLARLYKGKPLALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPTIVSS
PGLKSIKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRKHFDVIAE
QQVYQNIDVVLGGGKAALLPIKRKDGEDLVKVIQNKGYDFIETKEALLKSKSNKMWGSFS
HNALAFDMDREATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDPIGMI
SDVLAFDNAVAEALRFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPVSTYIDPLK
KAKMTLEGTINNLKSDISNVEEVAKLYGLDNLTYDEKERLKVVKKKIDVGPIFTTLLANR
ANIGFTTGGHTGEDVFLYSYGPQKPVGLIQNTDVAKTMAKAMGFNLEEVTNKLFVESELA
FKQNGATVTVDNTNAVNPVLIVKRNNVTAQLFVNKNIIRIKNKDYELGSVVVESNGKFYV
PEEASRLFIKHSR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtattgggtttaaagatgaagaagttactgttagtaggaacgatcacactaagt
atgttatgtactgaaagtatgatggatgatcatacggtggaagcgaaagtgaaaaaagta
gaacgtcaaccgaaaaatgtaatcataatggttatggacggaacgagttcttcagcaact
acattagctcgcttgtataaagggaaaccacttgcattagatgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcgaattctggatatgtaggggtattacctactattgtgagttca
cctggcttaaaatcaataaaagaagaggacaagttacgtccagttgccaatgttttagaa
ggtgcgaaacgtactggtcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcccgctggattctctgctcaccatgtaaaccgcaagcattttgacgtaattgcggag
caacaagtgtatcaaaatatagatgtcgtattaggcgggggaaaagcggcactgctacct
ataaaaagaaaagatggtgaagatttagtaaaagtgattcaaaataaaggctacgacttt
attgaaacgaaagaggcattattgaaatctaaatctaataaaatgtggggctctttctca
cataatgccttagcgtttgatatggatcgtgaagcaacaaatccggagcaaccaacactt
tcgcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagatgggttcttttta
tttgtggaaggaagtaagccagattgggctgcacatgtgaatgatccaattgggatgatt
agtgatgtattggcatttgataatgcagttgcagaagcattaagatttgcaaaaaaagat
ggtaatacgatgctaatagccgtagcggaccatggtaacagcggtatttctattggcaat
atgaatacgacaaaaggttataatactacgccggtctctacatatattgatccgttgaaa
aaagcgaaaatgacacttgaaggaactatcaataatttgaaatctgatatatccaatgta
gaagaggtagctaaattatacgggttggacaatttaacttatgatgaaaaagaaaggtta
aaagtggttaaaaagaaaatagatgtaggtccaattttcactacattattggctaaccgt
gcgaacataggcttcacaacaggagggcatactggtgaggatgtatttttatattcatac
ggtcctcaaaagccagttggtttgattcaaaacacggacgttgcaaagacaatggcgaaa
gcgatgggctttaatttagaagaagtaacaaacaaattatttgtagagagtgaattagcc
tttaagcagaatggtgcgactgtaacagtagataatactaatgcagtaaatcctgtgctc
atagtaaaacgtaataatgtaacagctcaattatttgttaacaaaaatataattcgtatt
aagaataaagattatgaattaggaagtgttgttgtagaaagcaatggtaaattctatgta
ccagaagaagcaagtcgtttattcataaagcattctcgttaa

DBGET integrated database retrieval system