KEGG   Bacillus cereus ATCC 10987: BCE_3409Help
Entry
BCE_3409          CDS       T00162                                 

Definition
transaldolase, putative
Orthology
K00616  
transaldolase [EC:2.2.1.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bca01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bca00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3181897..3182565)
Genome map
AA seq 222 aa AA seqDB search
MKFFIDTANLEDIKKAYKLGVLAGVTTNPSLVAKEGIKFEDRIAEICQAVPKVESVSAEV
TPDAVTAEEMIAQAEELIKINGGDEKVTIKLPMTLAGLEACRYLTEKGVKTNVTLIFTVN
QALLAARAGATYVSPFLGRLDDISEDGVLLVAKIAELFDVHQLDTQIIAASVRHPDHVTR
VAMAGAHIATIPYKVIEQLAMHPLTDQGIEKFAADWAKAPKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttattgatactgcaaatcttgaggacataaaaaaagcatataaacttgga
gttttagctggtgttacaacgaatccttctttagtagcaaaagagggcattaagtttgaa
gaccgtattgcagaaatttgtcaggcagtgccgaaagttgaatctgtttcggcagaagta
acgccagatgctgtgacagctgaagaaatgattgctcaagcagaagaactgattaaaatt
aacggtggcgatgaaaaagttacaatcaaacttccgatgacgctagcaggattagaagct
tgtcgctatcttactgaaaaaggtgtaaaaacgaacgttacccttattttcacggtgaac
caagcacttttagctgctcgagcaggtgcaacgtatgtttctccgtttttaggacgctta
gatgatatttctgaagatggcgtattattagttgctaaaattgctgaattattcgatgtt
catcaattagatacacaaattattgccgcttctgttagacatccagaccatgtaactcgt
gtagcgatggcaggtgctcacattgcaacaattccttataaagtaattgaacaacttgct
atgcacccattaacagatcaaggtattgagaaatttgctgcggattgggcgaaagctcct
aaattataa

DBGET integrated database retrieval system