KEGG   Bacillus cereus ATCC 10987: BCE_3409Help
Entry
BCE_3409          CDS       T00162                                 

Definition
transaldolase, putative
Orthology
K00616  
transaldolase [EC:2.2.1.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_3409
   01230 Biosynthesis of amino acids
    BCE_3409
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCE_3409
Enzymes [BR:bca01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     BCE_3409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3181897..3182565)
Genome map
AA seq 222 aa AA seqDB search
MKFFIDTANLEDIKKAYKLGVLAGVTTNPSLVAKEGIKFEDRIAEICQAVPKVESVSAEV
TPDAVTAEEMIAQAEELIKINGGDEKVTIKLPMTLAGLEACRYLTEKGVKTNVTLIFTVN
QALLAARAGATYVSPFLGRLDDISEDGVLLVAKIAELFDVHQLDTQIIAASVRHPDHVTR
VAMAGAHIATIPYKVIEQLAMHPLTDQGIEKFAADWAKAPKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttattgatactgcaaatcttgaggacataaaaaaagcatataaacttgga
gttttagctggtgttacaacgaatccttctttagtagcaaaagagggcattaagtttgaa
gaccgtattgcagaaatttgtcaggcagtgccgaaagttgaatctgtttcggcagaagta
acgccagatgctgtgacagctgaagaaatgattgctcaagcagaagaactgattaaaatt
aacggtggcgatgaaaaagttacaatcaaacttccgatgacgctagcaggattagaagct
tgtcgctatcttactgaaaaaggtgtaaaaacgaacgttacccttattttcacggtgaac
caagcacttttagctgctcgagcaggtgcaacgtatgtttctccgtttttaggacgctta
gatgatatttctgaagatggcgtattattagttgctaaaattgctgaattattcgatgtt
catcaattagatacacaaattattgccgcttctgttagacatccagaccatgtaactcgt
gtagcgatggcaggtgctcacattgcaacaattccttataaagtaattgaacaacttgct
atgcacccattaacagatcaaggtattgagaaatttgctgcggattgggcgaaagctcct
aaattataa

DBGET integrated database retrieval system