KEGG   Bacillus cereus ATCC 10987: BCE_3860Help
Entry
BCE_3860          CDS       T00162                                 

Gene name
proS
Definition
prolyl-tRNA synthetase (EC:6.1.1.15)
Orthology
K01881  
prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bca00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCE_3860 (proS)
Enzymes [BR:bca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     BCE_3860 (proS)
Amino acid related enzymes [BR:bca01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BCE_3860 (proS)
Transfer RNA biogenesis [BR:bca03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCE_3860 (proS)
 Prokaryotic Type
    BCE_3860 (proS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3609214..3610914)
Genome map
AA seq 566 aa AA seqDB search
MKQSMVFSPTLREVPADAEIKSHQLLLRAGFMRQNASGIYSFLPFGLKVLHKVERIVREE
MERAGAVELLMPAMQAAELWQESGRWYSYGSELMRMKDRNAREFALGATHEEVITDLVRD
EVKSYKKLPLTLYQIQTKFRDEQRPRFGLLRGREFLMKDAYSFHATQESLDEVYDRLYKA
YSNIFARCGLNFRAVIADSGAMGGKDTHEFMVLSDVGEDTIAYSDTSDYAANIEMAPVVA
TYTKSDEAEKALEKVATPDQKAIEEVSAFLNIEAEKCIKSMVFKVDEKLVVVLVRGDHEV
NDVKVKNVYGASVVELASHEEVKELLNCEVGSLGPIGVTGDIEIIADHAVASIVNGCSGA
NEEGFHYVNVNPERDFKVSQYTDLRFIQEGDQSPDGNGTILFARGIEVGHVFKLGTRYSE
AMNATFLDENGKTQPLIMGCYGIGVSRTVAAIAEQFNDENGLVWPKAVAPFHVHVIPVNM
KSDAQREMGENIYNSLQEQGYEVLLDDRAERAGVKFADADLFGLPVRVTVGKKADEGIVE
VKVRATGESEEVKVEELQTYIANILK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagtatggtatttagtcctacattacgtgaagttccagctgatgctgaaatt
aagagtcatcagttattacttcgtgcaggttttatgcgtcaaaatgcttctggtatttat
agctttttaccatttggattaaaagtgctacacaaagtagaacgaatcgttcgagaagaa
atggagcgcgcaggtgctgtagaattattaatgccagcgatgcaagctgcagaattatgg
caagagtcaggtcgttggtattcttacggatctgaattaatgcgtatgaaagatcgtaac
gctcgtgaatttgcattaggagcgacacatgaagaagtaattacggatcttgtacgtgat
gaagtgaaatcatataaaaaattaccgttaacattatatcaaattcaaacaaaattccgt
gatgaacaaagacctcgtttcggtttattacgtggaagagagtttctaatgaaagatgca
tactctttccatgctacacaagagagcttagatgaagtgtacgatcgcttatacaaagca
tactctaacattttcgctcgttgtggcttgaatttccgtgcggttattgctgattcagga
gcaatgggcggaaaagatacacatgaatttatggtattatctgatgttggtgaagataca
attgcatactcggatacatctgattatgcagcgaacatcgaaatggctcctgttgtagct
acgtatacgaagagtgacgaagcagaaaaagcgcttgaaaaagtagcaacaccagaccaa
aaagcaattgaagaagtatctgccttcttaaacatagaagctgaaaagtgcattaagtct
atggtatttaaagtagatgagaaattagtagttgtacttgttcgtggtgatcatgaagta
aacgatgtaaaagtgaaaaatgtatacggtgcttccgttgttgagcttgcctctcatgaa
gaagtaaaagaattattaaattgtgaagttggttcattaggtccaattggtgtaacaggt
gatattgaaattattgctgatcacgctgtagcatcaattgtcaacggatgttcaggagcg
aacgaagaagggttccattatgtaaatgtaaatccagaacgtgactttaaagtaagtcaa
tatacggatttacgattcattcaagaaggagaccaatctccagacggaaacggaacaatt
cttttcgcacgcggaattgaagttggtcatgtatttaaattaggaactcgttatagtgaa
gcaatgaacgcaacattcctagatgaaaacggaaaaacacaaccacttattatgggttgt
tacggcattggtgtgtctcgtacagtggcagcaattgcagagcagtttaatgatgagaac
ggtttagtttggccaaaagctgttgcaccgttccatgtgcatgtaattccagtaaatatg
aaatctgatgcacaacgggaaatgggtgaaaacatctataactcattacaagagcaagga
tatgaagtattactagatgatcgtgcagaacgtgcaggcgttaaatttgctgatgctgat
ttattcggccttccagttcgcgtgacagttggtaaaaaagcagacgaaggtattgtagaa
gtgaaagtacgtgctacaggtgagtctgaagaagtgaaagtagaagagcttcaaacatat
attgccaatattttaaaataa

DBGET integrated database retrieval system