KEGG   Bacillus cereus ATCC 10987: BCE_3878Help
Entry
BCE_3878          CDS       T00162                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00020  Citrate cycle (TCA cycle)
bca00640  Propanoate metabolism
bca00660  C5-Branched dibasic acid metabolism
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01200  Carbon metabolism
Module
bca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCE_3878 (sucC)
   00640 Propanoate metabolism
    BCE_3878 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BCE_3878 (sucC)
Enzymes [BR:bca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCE_3878 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AAS42783
UniProt: Q732N4
Position
complement(3627803..3628963)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDA
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcggcgaaagaattaggaacg
gatgtatgtgtagtgaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagaccgtgcaacttctcaa
gttgttttaatggcttctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
cctgaaaaaatctttaaagaatatattgatccagcagtaggcttacaaggcttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcttttatcgaaaaagattgctctatcgcagagattaaccca
cttgttacaacaggtgatggtaaagttatggcattagatgcgaaattaaactttgattct
aatgctttatatcgccataaagacattttagaacttcgtgaccttgatgaagaagatgca
aaagaaatcgaagcttctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctactatggatatcattaaacattaccat
ggagatccagctaactttttagatgttggtggcggtgcgacagctgaaaaggttacagaa
gcattcaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgaattgcctttagttgtacgtcttgaaggtacaaacgtagagttaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system