KEGG   Bacillus cereus ATCC 10987: BCE_3914Help
Entry
BCE_3914          CDS       T00162                                 

Definition
guanylate kinase, putative
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCE_3914
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BCE_3914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3663414..3664058)
Genome map
AA seq 214 aa AA seqDB search
MRKGRFYIFMRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVD
GVDYFFKEREEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQ
VKKAFPEGVFIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVEND
QVELACERIKAIVVGEHCRRERVAKYYKEMTEGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaagggtaggttttacatatttatgagaagtagaagaggattgctcatcgttctt
tcaggaccttctggggttggtaaaggaacggttcgaaaagagctgtttagtcatgaggat
acacgttttcagtattccatttcagtaacgacacgtaagccgcgtgaaggtgaagtggat
ggtgtggattatttctttaaagagagagaagaatttgaggaaatgattcgtaatgaaaaa
ttacttgagtgggctgagttcgtaggtaattattacggaacaccaattgactatgttgaa
aaaacattacaagaaggaaaagatgtattcttagaaattgaagtgcaaggagcaattcaa
gttaagaaagctttcccagaaggtgtatttattttcttagcacctccaagtttatctgaa
ctaaagaaccgaattgtcggtcgtggtacagaaactgaagatgttattgaaaatcgttta
acggtagcgaaagaagaaattgatatgatggacgcttacgactacgttgtagaaaacgac
caagttgaactagcttgtgaaagaattaaagcaattgtggttggcgaacattgccgccgc
gaaagagtagcaaaatattataaagaaatgacggagggtctataa

DBGET integrated database retrieval system