KEGG   Bacillus cereus ATCC 10987: BCE_3934Help
Entry
BCE_3934          CDS       T00162                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bca00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bca00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3686051..3686965)
Genome map
AA seq 304 aa AA seqDB search
MSHLLTMSELSEVEISEILKDAEDFANGKESKTTEQTFVANLFFENSTRTRFSFEVAEKR
LGLDVLNFSADASSVQKGETLYDTIRTLESIGTKAVVIRHEQDRYFDELKDQVNIPILNA
GDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKLGATIYFAS
PEEWKDEDNTFGTYKPLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEKHGLTVEREQ
RMKEGSIIMHPAPVNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGMKH
ELLV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgttaacgatgagtgaattatccgaagtagaaatttcagaaatcctaaaa
gacgcagaagattttgcgaatgggaaagaaagcaaaacgacagagcaaacttttgttgcg
aacttgttctttgagaatagtacgagaacaagatttagctttgaagttgctgagaagaga
ttaggacttgatgttttaaacttttcagctgatgcatctagcgtacaaaaaggagaaaca
ttatacgatacgataagaacactagaatcaatcggaacaaaagcagtggtcatccgccac
gagcaagatcgctacttcgatgaactaaaagatcaggtgaatattccaatcttaaacgct
ggagatggatgtgggaaccacccaacgcagtgcttactcgaccttcttaccattaaacaa
gagtttggaagatttgaaggattgaagattgcgatagtaggagatgttcgtcatagccga
gtagcacgttcgaatgcagaagcattaacgaaactgggtgcaacaatttacttcgcaagt
ccagaagagtggaaagatgaagacaacacatttggaacatacaaaccattagatgagctt
gttccagaagtggatgtaatgatgttacttcgtgtacaacatgagcgtcatgatcattat
gaaacagacattatgaaagagtatcatgagaaacacggattaacagtggaaagagaacag
cgtatgaaagaaggaagcattattatgcatccagctcctgtaaaccgagatgttgaaatt
gcaagtgaacttgttgagtgtgagcgttcacgcatatttaaacaaatggaaaatggagtt
tacgtaagaatggctgtactaaaacgcgccttaccaaatgtattaggaggaatgaaacat
gaattacttgtttaa

DBGET integrated database retrieval system