KEGG   Bacillus cereus ATCC 10987: BCE_3994Help
Entry
BCE_3994          CDS       T00162                                 

Gene name
pyc
Definition
pyruvate carboxylase (EC:6.4.1.1)
Orthology
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bca01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bca00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bca00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3741359..3744805)
Genome map
AA seq 1148 aa AA seqDB search
MTKLQRIQKVLVANRGEIAIRVFRACSELGLKTVAIYSKEDSGSYHRYKADESYLVGEGK
KPIDAYLDIEGIIEIAKSNHVDAIHPGYGFLSENIQFAKRCEEEGIIFIGPKSKHLDMFG
DKVKARTQAQLAQIPVIPGSDGPVDSLEEVEEFAEKYDYPIIIKASLGGGGRGMRIVRTS
EELRESYNRAKSEAKAAFGNDEVYVEKFVEKPKHIEVQILADEEGNVVHLYERDCSVQRR
HQKVVEIAPSVSLSDDLRQRICDAAVKLTKNVNYLNAGTVEFLVKDDNFYFIEVNPRVQV
EHTITEMITGVDIVQSQILIADGHALHSKLVGVPKQEEVVVHGFAIQSRVTTEDPLNNFM
PDTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKVTTWALTFEQAAAKMERNLK
EFRIRGIKTNIPFLENVVKHKNFLSGEYDTSFIDASPELFLFSKRKDRGTKMLNYIGTVT
VNGFPGVGKKEKPIFPDARIPNVLHSEPIQNGTKQILDERGADGLVKWVQDQKRVLLTDT
TFRDAHQSLLATRIRTKDLHQIAEPTARMLPNLFSAEMWGGATFDVAYRFLKEDPWERLL
DLREKMPNVLFQMLLRSSNAVGYKNYPDNLIQKFVECSAQAGIDVFRIFDSLNWVEGMRV
AIDAVRDTGKIAEATMCYTGDIHDPLRSKYDLNYYKNLAKELEASGAHILGIKDMAGLLK
PNAAYDLVSALKETVSIPIHLHTHDTSGNGILTYTKAIEAGVDIVDVAVSSMAGQTSQPS
ANTLYYALGGNERQPDVNIDSLEKLSHYWEDVRKYYAPFESGMNAPHTEVYMHEMPGGQY
SNLQQQAKAVGLGDRFDEVKVMYRRVNDMFGDIVKVTPSSKVVGDMALFMVQNHLTEQDV
LERGHSMDFPGSVVEMFSGDLGQPYGGFPKKLQEIILKGKEPLTVRPGELLEPVDFDALK
EELFHKLGREVTMFDVVAYALYPKVFMDYEKVAEIYGNVSVLDTPTFFYGMRLGEEIDVE
IEQGKTLMVKLVSIGEPQPDGNRVLYLEFNGQPREIVVKDESVKATVAQRVKGNRENPNH
ISATMPGTVIKVVVKEGDEVKKGDSMAITEAMKMETTVQAPFNGKVKKVYVNDGDAIQTG
DLLIELDH
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagctgcaacgtattcaaaaagtattggtagctaaccgtggagagattgcaatt
cgtgtgtttcgagcttgttcggaactgggattaaaaacagttgcaatctattctaaagag
gatagtggttcttatcatcgttataaagccgatgaatcctatttagttggggaaggaaaa
aagccaattgatgcttatctagatattgagggcattattgagattgcgaaaagtaatcat
gtagatgcaatccaccctggatatggtttcttgtcagaaaatattcaattcgcaaaacgt
tgtgaagaagaagggattatctttatcggtccaaaaagtaagcatttagatatgtttgga
gataaagtaaaagcaagaacacaagcgcagctagcacaaattccagttattcctggtagt
gatgggccagtagattcattagaagaagtcgaagaatttgctgaaaagtatgattacccg
attattattaaagcttcccttggcggtggcggtcgtggtatgcgtattgtacgtactagt
gaagaattaagagaatcgtataatcgagcaaagtcagaagcgaaagcagcctttggcaat
gatgaagtatacgtagaaaaattcgttgaaaaacctaaacatatagaagttcaaatttta
gcagatgaagagggcaatgttgttcatttatacgagcgagactgttctgtacaacgtcgt
catcaaaaagtagtagaaattgcacctagtgtgtcgctttcagatgatttgcgtcagcgt
atttgtgatgctgctgtgaaattaacgaaaaatgtaaattatttaaacgcaggaacagtt
gaatttcttgtaaaagatgataatttctatttcattgaagtaaatccgcgtgttcaagta
gaacatacaattacagaaatgattacaggagtcgatatcgttcaatcacaaattttaata
gctgatggacatgcattacatagcaaattggtgggtgttccaaagcaagaggaagttgtt
gtacatggatttgcaatacaatctcgagtaacgactgaggatccactaaataatttcatg
ccggatacaggaaaaattatggcatatcgatcaggtggtggctttggagttcgtcttgat
acaggtaatagtttccaaggtgctgttattacaccgtactatgattctttacttgtaaaa
gttacaacatgggcgcttacttttgaacaagctgctgcaaaaatggaacgtaacttaaaa
gaattccgtattcgtggtattaaaacgaatattccattcctagagaatgtagtaaaacat
aaaaacttcttatcaggggaatatgacacttcatttattgatgcgtcacctgaactattc
ttgttctcgaaacgtaaagaccgaggaacgaaaatgttaaattacatcgggacagtaaca
gtaaatggcttcccaggagtagggaaaaaagagaaaccaattttcccagatgctcgtata
ccgaatgtattacactcagagccaatccaaaatggaacgaaacaaattttggatgagcgt
ggagcagacggattagtaaaatgggtacaagatcaaaaacgtgtacttttaacggataca
acattccgtgatgcgcatcagtcattacttgcaacgcgtattcgtacaaaagatttacac
caaattgcagagccgacagcgagaatgttaccgaacttattctcagcagaaatgtggggc
ggtgcgacgtttgatgttgcatatcgtttcttaaaagaagatccgtgggaacgattacta
gatcttcgtgaaaaaatgccaaatgttttattccaaatgttacttcgttcttcaaacgcg
gttggttacaaaaactatccggataatttaattcaaaagtttgtggagtgttctgctcaa
gctggaattgatgtgttccgtatttttgatagcttaaactgggtagaaggtatgagagtt
gcgattgatgctgtacgagatactggtaaaattgcagaagcaactatgtgttacacaggg
gatattcatgatccgttacgtagtaaatatgatttaaattactataaaaatttagcaaaa
gaattagaagcatcaggagctcacattttaggtattaaagatatggcgggcttactaaaa
ccaaatgcagcatatgatttagtttcagcattaaaagagacggtatcgattccgattcac
ctgcacacacacgatacgagtggaaatggtatattaacgtatacgaaagcaattgaagca
ggtgttgacattgtcgatgtagcagtaagttctatggctggtcaaacgtcacaaccaagt
gcgaacacgctatactatgcgttaggtggaaacgaaagacagccagatgttaatatagat
tcattagaaaaattatctcattactgggaagatgtacgtaaatactacgcaccgtttgaa
agtggtatgaatgctcctcatacagaggtatatatgcacgaaatgccaggcggacagtat
agtaatttacaacaacaagcgaaagcggttggcttaggcgatcgtttcgatgaagtgaaa
gtaatgtaccgccgtgtgaatgacatgtttggtgatattgttaaagtaacgccatcatct
aaagttgtcggtgatatggcattattcatggttcaaaatcacttaacagaacaagatgtt
ttagagcgtggacattctatggacttcccaggatctgttgttgaaatgttctctggagat
ttaggacaaccatatggtggtttcccgaaaaagttacaagaaattattttaaaagggaaa
gaaccattaacagtaagaccaggtgaattattagaaccagtagatttcgacgcgttaaaa
gaagagctattccataaacttggacgcgaagtgacgatgtttgatgtagttgcatatgca
ttatatccaaaagtatttatggattacgaaaaagttgctgagatttatggaaatgtatct
gtgcttgatacaccgacattcttctatggtatgagacttggtgaagaaatcgatgtggaa
attgaacaaggtaaaacattgatggttaaactagtatcaattggagagcctcagccagat
ggaaatcgtgttctttacttggagtttaacggtcaaccacgtgagattgttgtgaaagac
gaaagtgtgaaagcgacagttgcacaacgtgtgaaaggaaaccgtgaaaatccaaaccac
attagcgcaacaatgccaggaacggttattaaagtagttgtaaaagaaggcgatgaagtg
aaaaaaggcgattctatggcaattacagaagcgatgaaaatggaaacgacagttcaagcg
ccgtttaatggtaaagtgaaaaaagtatatgttaacgatggagatgcaattcaaacgggt
gacttactcattgaattagatcactaa

DBGET integrated database retrieval system