KEGG   Bacillus cereus ATCC 10987: BCE_4084Help
Entry
BCE_4084          CDS       T00162                                 

Definition
oxidoreductase, short-chain dehydrogenase/reductase family
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BCE_4084
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BCE_4084
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BCE_4084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3819092..3820078
Genome map
AA seq 328 aa AA seqDB search
MTCRHNSNPPTILFYKIDKRKYLALQNSIAKTILQNKIANNIFPNLCRIFIIHSLNKAIG
ELYYEGMFFIMVTNRVVFLTGAASGIGYEMGHAFAKEGAKVVITDRLEERAKEAAEQLQK
EGFQAIGLKCDVTSEEEIEASISQTVTHFGSLDILINNAGMQHVSPIEDFPTEKFELLIK
IMQIAPFIAIKHAFPIMKKQKYGRIINVASINGLVGFAGKSAYNSAKHGVIGLTKVAALE
GATHGITVNALCPGYVDTPLVRNQLQDLATTRNVPLENVLEEVIYPLVPQKRLLQVQEIA
DYAIFLASEKAKGITGQAVVIDGGYTAQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgacttgtcgacataattcaaatcctcccactatcttgttttacaagatagacaagcgt
aagtatcttgctttacaaaatagtatagcaaagactattttgcaaaacaagatagctaac
aatatttttccaaatctttgcaggatttttattatccactctctaaataaagcgatagga
gaactttattacgaagggatgtttttcatcatggttacaaatcgagttgtttttttaaca
ggtgctgcaagtggtattggttatgaaatgggacacgcttttgcaaaagaaggtgcaaaa
gttgttattaccgatcgtcttgaagaacgtgcaaaagaagctgctgaacaactacaaaaa
gagggatttcaagctatcggcttaaaatgtgatgttacatccgaagaagaaatagaagca
tccatttcccaaactgttactcatttcggttcattagacatattaattaataacgcaggc
atgcaacacgtttcaccaattgaagattttccaaccgaaaagtttgagctactaattaaa
attatgcaaatcgctccttttatcgccattaaacatgcctttccgattatgaaaaagcaa
aagtatggccgaattattaatgtcgcttccattaatggcctcgttggatttgcagggaaa
tccgcctacaatagcgcgaaacatggtgtaattggattaacaaaagttgctgctttagaa
ggcgctacgcatggtattactgtaaatgcactgtgtcctggttatgtcgatacccctctt
gtacgtaatcaactacaagacttagctactacacgaaatgtaccacttgaaaatgttttg
gaggaagtcatttatccacttgtaccgcaaaaacgcttattacaagtacaagaaatcgcg
gattatgcaatctttttagcgagcgaaaaagcgaaaggtataaccgggcaagctgtcgtt
atcgatggtggttatactgctcaataa

DBGET integrated database retrieval system