KEGG   Bacillus cereus ATCC 10987: BCE_4106Help
Entry
BCE_4106          CDS       T00162                                 

Definition
5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase, putative
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bca00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3838730..3839242
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEINTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLKENYSLTDENKAEILAVF
SKEIADVSSRRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaaataaatactcgcattgaaaatgaagtggaagtatca
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttccaaacttcctact
catttaaaagaaaattactcattaacagatgaaaacaaagctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcatcacgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaactattaattaatttccaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system