KEGG   Bacillus cereus ATCC 10987: BCE_4343Help
Entry
BCE_4343          CDS       T00162                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_4343 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_4343 (glcK)
   00052 Galactose metabolism
    BCE_4343 (glcK)
   00500 Starch and sucrose metabolism
    BCE_4343 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BCE_4343 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCE_4343 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BCE_4343 (glcK)
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCE_4343 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4029051..4030034)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggc
gaattaaaaagtaagttaatcggtattggtatgggagctcctggccctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaagaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgtgattgataatgatgcgaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggagcaaaagatttaatttgtatgacgcttggc
actggtgttggcggcggtgtaattgccaatggagagattgtacacggcgtaagcggtgct
gctggtgaaatcggacacattacagtcgttacagagaatgctttcccatgtaattgtggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtgcgtgttgctatgcaa
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaaggacgt
atcacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttctagcacgttgaac
ccagagaaaatcgttattggcggaggtgtttctaaagctggagatgcacttttagaacca
attcaacgctattttgagcaatatgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system