KEGG   Bacillus cereus ATCC 10987: BCE_4477Help
Entry
BCE_4477          CDS       T00162                                 

Definition
helicase, putative
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCE_4477
Enzymes [BR:bca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCE_4477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4145015..4147351)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEYAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLSVQYAPLQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgatgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacagggcattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagctgaaaaaattgtg
gaccatctaggggaatatgctatttctaaaattatggatgatcctgaggctttaaatggt
gttgtaaacaagcaaaaagcgcaagaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
taccaacaatataaagagatgacattagaagtgattcgtaataatccatatcagcttatt
gaagaagtggatggaattggatttggaagagcggatgatataggacgtgcgttagggata
tcgggtaatcatgatgatcgtgtacgtgcgggatgtttttatacgttagagaatgtatca
ttacaacttggtcacgtttatatgagaaaagatcaacttgtaagagaaacgatgtcactt
ttaaataatcaagaaggaagagtgacggaggaagacattataggttgtattgaaatgatg
caaagtgaagggaaagtcattattgaagaagaacgagtgtatttggcatcgttattctac
tctgaaaaaggtgttgtaaagtctattcgcaggctcatgaatcaggaggaaacaccttca
ttccctgaagcagaagtgttaaagacgttaggtgaaattgaagaacaactgagcgtacag
tatgcaccacttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattg
acaggtggaccaggaacaggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatacagtgatgataatccatttccgata
ttattaacggctccaacaggaagggcagcgaagcgaatgagtgaatcgacaggacttcca
gcttgtacaattcaccgtttacttggctggacgccagaagggtctttccagcgtaatgaa
acagatccggtacaagggaagttgcttattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgacgaacattcaagttatcgttgtaggtgat
gaagatcaattaccatctgtaggacctggacaagtattgaaagatttattgaatgcaggt
gcagttccaactgtaaagcttactgaaatttatcgtcaagcggaaggttcatcagtaatt
caacttgctcatgcgataaaaaatggaacactcccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgcacaggagctcaaattgttgaggttgttaagaaggtttgt
gaaaatgctaagacaaaaggttttagtgcaagagatgtacaagtattggccccgatgtat
cgtggaccggccggtattaatgtactaaacgaagcgttgcaagaagtatttaatccgaaa
agggaaaagagtaaagaaattgcttatggtgatgttgtatatcgaagaggcgataaagtc
ttgcaactcgttaatcagccggagagtcaagtgtttaatggtgatatcggagaaattgtt
tcggtgttttatgcaaaagagaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcctattgctgt
tccattcataaatcgcaaggtagtgagtttccgattgtaattatgccgatagtaaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgctttccagtctggtgtaaaccgccttgatgatgca
atgcgtcaaacgactttagcgagtcgattgcaggaatcgcaaggagaagtacagatggta
acagtgaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system