KEGG   Bacillus cereus ATCC 10987: BCE_4781Help
Entry
BCE_4781          CDS       T00162                                 

Definition
acetyl-CoA synthetase, putative
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bca01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bca00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bca00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bca00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bca00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4425266..4426834)
Genome map
AA seq 522 aa AA seqDB search
MAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIKSGLQKG
DKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSYEPYIGQ
FDDIEAMDSLQKFVLSEQSVDGWINLKTALEKESDMLEMAKTDKEDMVFLSYTSGTTGNP
KGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGATGFVYH
GKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPLNREVIE
TFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGVPVKVGEV
GDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDDIIISSG
YTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIPILQQHV
KELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccgccgtcttataatttagtttctgaaatagagaaatatacaggtgataaagag
aagcttgctttaatttggcaagatgataaagggaatcgacgagaagttacatacgctgag
ttaatgaaaggtgcaaataaaattggaaacgcttttataaagagtggtctgcaaaaaggg
gacaagctcctcattatgatgcctcgtttaattgaagcgtacatgacgtatatcgctgcg
attaaagcaggatttgtcgtaattccgagttcagaaatgttacgtaaaaaggatatcgaa
taccgcattggacacggggaagtaaaagcaatcgtaagttatgagccctatattggacag
tttgatgatatagaagcgatggattctcttcaaaaattcgttctgagcgagcagtcagta
gatggatggattaacttaaaaacagcgttagaaaaagagagtgatatgttagaaatggcg
aagacagataaagaagatatggtctttttatcttacacgtcaggaacgacaggaaatcca
aaaggtgttgtgcatacgcatgcgtgggcatacgctcatttacgtacgagcgctccaaat
tggctcggaattgaagagaatgatgttgtatgggcgacggctagtccaggctggcaaaag
tggatttggagcccgtttttagcaactctaggctcaggggcaacaggatttgtataccac
ggtaagtttgaaccgaaaacgtatttaaatttattagacgataataaggtgaatgtgctt
tgttgtacgccgactgagtatagattaatggcaaaggtagaaaatttaagcgagtacaat
ttagaagcgttacatagcgctgtatccgcaggtgagccgttaaatagagaagtcattgaa
acgttccaaaagcactttcatattacagtaagagacggctatgggcaaacggaaaataca
ttgcttgttggtgtaatgaaagggatggatattagaccaggatcaatgggaaaaccaacg
ccaggcaaccacgttgatatcgtaaatgaggaaggtgttccggttaaagtaggcgaggtt
ggtgatattgcagttcacattgaaacgccagccctctttaaacaatattacaaagacgat
gagcgcacagcgatgcaattccgcggtgattattatattactggtgataaagcgaagaaa
gatgaagacggctatttctggtttgaagggcgcggtgatgatattattattagctctggt
tatacaatcgggccgtttgaagtagaagatgcacttgtaaaacatccttacgtaagagaa
tgtgcagttgtcgcaagccctgatgaaattcgcggaagtgtcgtgaaggcatttatcgta
ttaagagagaatatagaaaagaacgaagaaacattaattccaatactccaacaacacgtc
aaagaacttactgcaccatataaataccctcgcaaaattgaatttgtagatgaactacca
aaaacgatttccggaaaaattcgccgtattgaacttagaaaacaagagatggagattccg
tcaaaataa

DBGET integrated database retrieval system