KEGG   Bacillus cereus ATCC 10987: BCE_4904Help
Entry
BCE_4904          CDS       T00162                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCE_4904
Enzymes [BR:bca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCE_4904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4533787..4534590)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHNGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFIFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattacgaagcggaggaagcaaaggctgtaatcgttattgtgcacggcgcgatg
gaatatcacggacgttatgaagccgttgcggaaatgtggaatcataacggctaccacgtc
gtgatgggagaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtataggtta
cctatttttatattcggtcatagtatgggtggtcttatcgtcattcgtatgatgcaagaa
acgaagagagaagatgtagacggtattattttaagttcgccatgtttaggtgtattagct
ggaccttctgcaccgctgcaagctgcctcaaaaatattaaatattatcgctccaaaattg
caatttgcaacgaatcttacagtggaaatgtcaactcgtaatcatgaagtgagagatgcg
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgcccataagaaaatagatgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttaccatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system