KEGG   Bacillus cereus ATCC 10987: BCE_5233Help
Entry
BCE_5233          CDS       T00162                                 

Gene name
estA
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4831142..4831882)
Genome map
AA seq 246 aa AA seqDB search
MKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEEL
VHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMYI
KSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDMI
YAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYNF
LEQLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgttttatta
ttacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaaaag
aaaggctacacttgtcatgccccaatttataaagggcacggtgtaccaccagaagagctt
gttcatacaggtcctgaagattggtggcaagacgtaacggaggcatatcagcttttaaaa
gataaaggttttgagaaaattgctgtcgttggattgtcacttggcggcgtattttctcta
aaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccgatgtatatt
aagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaagcgt
gagcaaaaatcaccagagcaaatcgaacaagaaatgttggaattccaaaagacaccgatg
aatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatgatt
tatgccccaacatttgttgtacaagcgcgtcatgatgaaatgattaatacagatagtgcg
aacattatttataacggtgtagaatcaacgttaaaagacattaaatggtatgaagactct
acgcatgtcattacacttgataaacagcgtgacgagctacatgaggatgtatataacttc
ttggagcaactagattggtaa

DBGET integrated database retrieval system