KEGG   Bacillus cereus ATCC 10987: BCE_5396Help
Entry
BCE_5396          CDS       T00162                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00040  Pentose and glucuronate interconversions
bca00052  Galactose metabolism
bca00500  Starch and sucrose metabolism
bca00520  Amino sugar and nucleotide sugar metabolism
bca01100  Metabolic pathways
bca01130  Biosynthesis of antibiotics
Module
bca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCE_5396 (galU)
   00052 Galactose metabolism
    BCE_5396 (galU)
   00500 Starch and sucrose metabolism
    BCE_5396 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BCE_5396 (galU)
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCE_5396 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: AAS44296
UniProt: Q72XI0
Position
complement(4985111..4985992)
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEETQSSVIGVQTVPENETHRYGIIDPIEKNER
RYQVRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGIRYDVGEKFGFIKTTIEMALQNEELNVELMKYMKELVKKEEAHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcaattattccagctgcgggactggggacaagatttttaccg
gtaacaaaggcaatgccgaaagaaatgttaccaattgttgataaaccaacaattcaatac
atagtagaagaagcgatagaatcaggaattgaagatattattattgttactggaaaagga
aagcgtgcgattgaggatcattttgatcattcattcgaactagagcaaaaccttttagaa
aaaggaaagtatgaaatgcttgaaaaggtacaagcttcttcaaaaattaatattcattac
ataagacaaaaagaaccaaaaggtttaggacacgcagtatggtgtgcacgtaaatttatt
ggaaatgaaccatttgcggtattacttggtgatgatattgtacaagctgaaacgccatgt
ttacgtcaattgatggatcaatatgaagagacacagtcgtcagttatcggtgtacaaaca
gtacccgaaaatgaaacacatcgttatggtattatcgatccaattgaaaaaaatgaacgt
cgttatcaagtgcgtcaatttgttgaaaagccagcagaaggtacagcaccatcgaattta
gcgattatgggtcgttacgtattaacaccagaaatctttatgttccttgaggatcagcaa
acaggtgctggtggagagattcaattaacagatgcaattcaacgtttaaatgaaattcaa
cgtgtatttgcttatgattttgaaggtattcgttacgatgttggggagaagtttggattt
attaagacgacaattgagatggcactacaaaatgaagaattaaatgtagagttaatgaag
tatatgaaagaacttgtaaaaaaggaagaggcacattcataa

DBGET integrated database retrieval system