KEGG   Bacillus cereus ATCC 10987: BCE_5498Help
Entry
BCE_5498          CDS       T00162                                 

Definition
agmatinase, putative
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCE_5498
Enzymes [BR:bca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BCE_5498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5086277..5087149)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESKVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDADKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcgaaggtagttatttatgggatgcctatggattggacagtaagttaccgtccggga
tctcgttttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagtccg
tatttagatcgtgaactagaagaggtaaaatattttgatgcgggtgatatcccattacca
ttcgggaacgcacagcgcagcttagacatgattgaagaatatgtatcaaaacttttagat
gccgataagtttccactaggtctcggcggtgagcacctagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccatatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacaccaattcgtaaagtgtgtgat
ttaattggtccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcaaaagaagtaggtatgaacttatataaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgcaggacgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggtggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagactta
gtagaagtagctcctgtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtgaaataa

DBGET integrated database retrieval system