KEGG   Bacillus cereus ATCC 10987: BCE_A0211Help
Entry
BCE_A0211         CDS       T00162                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCE_A0211
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BCE_A0211
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BCE_A0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
pBc10987:complement(181595..182338)
Genome map
AA seq 247 aa AA seqDB search
MGIRKNQACLTDEEKAAFVDAIQELKRNGEYQPYVDVHRKHFFHPIHQSAMFLPWHREFL
HKFEIELQKVNRNVTIPYWDWTVDNSITSSIWRGNFMGAFTGLNRQLGANPFLPTRTQVK
EAIDTTPYDTAPWRQVTSGFRSALEELHNGPHNWVGGVMAGAGSPEDPVFWLHHSNIDRL
WAIWQREHLNEPYLPTSGTTGADELGLDDPMHEFREGEKNTLTPKDVLDHTSLGYQYDNY
SLDPVDC
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggaataagaaaaaatcaagcatgtttgacagatgaagagaaggcagcttttgtagat
gcaattcaggaactaaaaagaaatggagaatatcaaccctatgttgatgtacatcgtaaa
catttttttcatcctatacatcaaagtgcaatgtttctcccatggcatcgtgaatttctt
cataaattcgaaattgaattacaaaaagttaatcgaaatgtgacaattccatattgggat
tggacggttgataattcaataacatcttcaatatggcgaggaaactttatgggagcattt
acagggctgaatcgtcaattaggtgcaaatccttttttgccaactcgtactcaagttaag
gaagctatagatacaacgccctatgatacagctccctggaggcaggtaacaagtggtttt
agaagtgcattagaagagttgcataatggtcctcataattgggttggaggagttatggca
ggagcaggatcacccgaagatccagttttttggttgcatcatagcaatattgatcgtctt
tgggctatatggcaaagagaacatcttaatgaaccttatttaccaactagtggtacaaca
ggtgcagatgaattgggactagatgatccaatgcatgaatttagagaaggagaaaaaaat
acattaactccgaaagacgtactagatcatacatctcttggatatcaatatgataactat
tcgttagatccagtagactgttga

DBGET integrated database retrieval system