KEGG   Bacillus cereus B4264: BCB4264_A0050Help
Entry
BCB4264_A0050     CDS       T00805                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00900  Terpenoid backbone biosynthesis
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01130  Biosynthesis of antibiotics
Module
bcb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCB4264_A0050 (ispE)
Enzymes [BR:bcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BCB4264_A0050 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Peptidase_C42
Motif
Other DBs
NCBI-ProteinID: ACK60409
UniProt: B7HIL3
Position
47998..48867
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDELAELGAEIGSDVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVDVINSGDYKGICDTVGNVLEDVTFGMHPEVARIKSQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaaccattgatttagcagatcgt
ctagaactaacggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaacgaaatttagcttatcaggcagcgaaattattaaaagagaagtttaat
gtaaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagca
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggg
cttacaattgatgagttagcagagcttggcgcagaaattggatcagatgtatcgttctgt
gtatacggaggcacagcaattgccactggaagaggagagaaaattgagcatataaagact
ccgccttcttgttgggttattttagcgaaaccacatataggtgtatctactgctgatgtg
tatggaaatttaaagttaaatcgagttacacatccgaatgtagataaaatggttgatgtc
ataaattctggtgattataaaggaatttgtgatactgttggtaacgttttagaagatgta
acatttggaatgcatcctgaagttgcccgtattaaatcacagatgaagcgatttggagcg
gatgctgtattaatgagtggaagtggtccaactgtatttggacttgtacaccatgattca
cgaatgcatcgcatttataacggattaaaaggattttgtgaacaagtctatgcggtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system