KEGG   Bacillus cereus B4264: BCB4264_A0079Help
Entry
BCB4264_A0079     CDS       T00805                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcb  Bacillus cereus B4264
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCB4264_A0079 (folP)
Enzymes [BR:bcb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BCB4264_A0079 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77421..78254
Genome map
AA seq 277 aa AA seqDB search
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNGVDAAVRHAKEMQGQGAHII
DIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIIN
DIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKNAGVPDEN
IILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGA
TVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgggattatgatttgcgctgcggcgaatatacattgaatttaaatgaaaaaaca
ttaattatggggattttaaatgtaacaccagattcgttttctgatggtgggagttacaac
ggggtagatgctgcggtacgtcacgcaaaagaaatgcaaggtcaaggtgctcatattatt
gatattggtggcgaatctactcgcccaggttttgctaaagtatcagtagaagaagaaata
aagcgagttgtcccgatgattcaagcagtttcaaaagaagtaaaattgcctatatctatc
gatacatataaagctgaagttgcaaagcaagcaattgaggctggtgctcatattattaat
gatatttggggagcgaaggcggagccaaaaattgctgaagtcgcagctcattatgatgta
cccatcattttaatgcataaccgcgataatatgaattatcgtaatttaatggcggatatg
attgctgatttgtatgacagtattaaaattgctaaaaatgctggtgtgccagatgagaat
attattttagatccaggtatcggttttgctaaaacacctgagcagaacttagaggcgatg
cgtaatttagaacagttaaatgtgctaggttatccggttctcttaggtacttcgagaaag
tcctttattgggcacgtattagatttgccagtggaggaacgtcttgagggaacaggagct
accgtttgtcttggtattgaaaagggctgtgagtttgttcgtgtccatgatgtgaaagaa
atggcgcgtatggctaaaatgatggatgcgatgattggtaagggggtaaggtaa

DBGET integrated database retrieval system