KEGG   Bacillus cereus B4264: BCB4264_A0081Help
Entry
BCB4264_A0081     CDS       T00805                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bcb  Bacillus cereus B4264
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78614..79129
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIQVDDISSVYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFES
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatatagcttacattgcattagggtcaaatattggagagcgttatacgtatctt
actgaagcgattcagtttttaaataaaaatccttatattcaggttgatgatatttcatct
gtatatgaaactgagccagttggctatactgaccaaagttgctttttaaatttagttata
aaaatttctaccaatttatcaccacaagagttattgaaagtaacacaaaaagtagaaaat
gacctaggaagaaaaagggaaattaggtgggggccgaggactatcgaccttgacatttta
ctttataatcaagagaatattgaagcagagaatcttattgttccgcatccgcggatgttt
gaaagagcttttgttatcgttccgttgttagagattaatcaagacataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaagctaa

DBGET integrated database retrieval system