KEGG   Bacillus cereus B4264: BCB4264_A0697Help
Entry
BCB4264_A0697     CDS       T00805                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcb  Bacillus cereus B4264
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCB4264_A0697 (rbsK)
Enzymes [BR:bcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BCB4264_A0697 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687081..687977
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDGTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLVKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggaagcatttcaatggacttagtggctgtttcaaaaaaa
cgcccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatcccaggagggaaa
ggggcaaaccaagcagttgctgcagctagattaggagcaaatgtagcaatggttggagcg
gtaggaaatgatgattatggaacagtagttagaaaaaatctagagaacgaacgcattttt
atcgattatgtggtaccggttacagatggaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggggcaaatgctcttgtaaataagtcagtt
gtagatcgctccaaagaccttcttgtaaaagcggatatggttgttcttcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggaacataatattcctgttatg
ttaaatccagcgccagcacaagttttatcagaagacattttagaaaaggcaacttatatt
acgccaaatgaacatgagtgccgcatcgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatcccaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggcacggagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggagagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggagca
cagggcggtatgccaacgagagatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system