KEGG   Bacillus cereus B4264: BCB4264_A1066Help
Entry
BCB4264_A1066     CDS       T00805                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCB4264_A1066 (glpK)
Enzymes [BR:bcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BCB4264_A1066 (glpK)
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCB4264_A1066 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1039903..1041393
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETTVVWDKTTSKPIYNAIVWQSRQTAEICDELKEKGYS
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDSWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLEMLTVPKSMLPEVRPSSEIYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRFEPTMEAKTSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaacaagctcacgcgcaattcttttc
aataaaaaaggtgaaattgttcattcagctcaaaaagagtttacacaacattttccaaag
ccgggctgggtagagcataatgcacaagaaatttggggatctattttagcagttatcgca
acttgcttaagcgaagcggatgtaaaaccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacaacggttgtatgggataaaacaactagtaaaccaatttacaacgcaatc
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatagc
gaaatggttcgcgaaaaaacaggtcttttaattgatgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgattcgtggcttgtatggaaactatctggtggtaaagcacacgtaaca
gattactcaaacgcatcacgtacgttaatgtttaacattcacgacttacagtgggatgat
gagcttctagaaatgttaacagtaccaaagagcatgcttccagaagtgcgtccatcatct
gaaatttacggagaaacaattgattatcacttcttcggccaaaatgtaccgattgcaggt
gtagctggtgaccaacaagcagcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgtttcatgttaatgaacactggtgaaaaagcagtagct
tctgagcacggcctattaacaacaattgcatggggaatagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcaggttctgcaattcagtggttacgcgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtatatgcttctcgcgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggtttaggaacaccttattgggatagtgaagtacgc
ggcgctatgtttggtgtaacgcgcggtacgacgaaagagcatttcattcgtgcaacgcta
gaatctttagcttaccaaacgaaagatgtattatgcgcaatggaagcagattcaggtatt
gagctgaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagatgttcctgtagagcgtccagtaatcaacgaaacaacggctcta
ggtgcagcatacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgctttgaaccaacgatggaagcgaaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system