KEGG   Bacillus cereus B4264: BCB4264_A1105Help
Entry
BCB4264_A1105     CDS       T00805                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcb  Bacillus cereus B4264
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080363..1081784
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PSTSVANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGAGLPDCMNQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcatcactggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgagcgcgga
ccagattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatcaagccggtcaatcatttatccttgtaaacaatcggtta
cataaaatgccgaatggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggctttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgtcttggaaacgaa
gtggttgaaaacttaatagagccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatg
ttccaaacagtgaaaacaggtttagaatctatcgtaaaatctctcgaagcaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcgaaacagggtgatggttat
acgattactcttagtaacggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccatccacatccgttgcgaatgtggcacttgctttccaaaagtctgcaatccagcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacaccattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttaaggaagacgatggatattacagaggatccagagtttacaatcgta
agtcgctggaaagaagcgatgcctcaatatacagtgggccataacgagcgaatgaaaaag
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagctcctatgct
ggtgctggacttccagactgtatgaatcaaggtgaggaagctgcaaagcgtgtattatct
catttggagaaagtaatagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system