KEGG   Bacillus cereus B4264: BCB4264_A1181Help
Entry
BCB4264_A1181     CDS       T00805                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcb  Bacillus cereus B4264
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A1181 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCB4264_A1181 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCB4264_A1181 (aceB)
Enzymes [BR:bcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCB4264_A1181 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1150779..1152368
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYSEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTM
TAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgttggagaaatgttaccagcgtacagcgaa
atattgacacctgaggtgcttagttttttgaaggaactacatgagaattttaatgagcgc
cgcatagaacttttacaaaaacgtgtagaaaaacaaaagagaattgatgcaggggagttt
ccgaagtttctagaagaaacaaaacacatacgtgaagcggattggacaattgccaagctg
ccaaaagacttagaggatcgccgtgtagagattactggaccggtagatagaaagatggtc
attaacgctttaaattcaggagcgcatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcagtggaaggccaaatcaatttacgagatgcagtaaagggaacg
atttcacatgaaaatgataaagggaaagaatatagattaaatgagaaaacagctgtactc
attgtacgtccaagaggatggcatttagaggaaaagcatatgcaagttgatgggaaaaat
atgtcgggtagtttagtagatttcggtttgtattttttccataatgcgaaagctctttta
gcaaaagggagcggcccatacttttacttaccgaaaatggaaagttatttagaagcgaga
ttatggaatgatgtattcgtatttgctcaaaaatatatcggcattccaaatggaacgatt
aaagcaactgtgttactagaaacgattcacgcttcgtttgaaatggatgaaattttatat
gagctaaaagatcattctgctggcttaaattgcggaagatgggattatatttttagcttt
ttaaagagtttccgtaatcataataaattcttactaccagatagagcacaagtcacgatg
acggcgccatttatgcgttcgtattctttgaaagtaattcaaacatgtcaccgccgtaat
gcaccagcaattggaggaatggcggcacaaattccgattaaaaataatccagaagcaaat
gaagcagcttttgaaaaagtgcgtgctgataaggaacgcgaagctttagacggtcatgac
gggacttgggtcgcccaccctggacttgtaccggttgcaatggaagtgtttaatcacatt
atgaaaacaccaaatcaaatttttagaaaacgtgaagaaatatgtgtaacagaaaacgat
ttactagaggtaccggtgggaacgattacagaagagggccttcgcatgaatattagcgta
ggtattcaatatattgcatcttggttaagcggacggggagcagcacccatttataactta
atggaagatgcggcaacagctgaaatttcaagagcacaagtatggcaatggattcgtcat
gaaggtggaaaactaaatgatggtcgtaatattacgcttgaattaatggaagagctaaaa
gaagaagaattagcaaaaatagaaagagagattggtaaggaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcgaaatgatgaattcgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system