KEGG   Bacillus cereus B4264: BCB4264_A1182Help
Entry
BCB4264_A1182     CDS       T00805                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bcb  Bacillus cereus B4264
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bcb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bcb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152392..1153669
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaagttgcaagaaagctgggaattagatgagcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcgggtcaattgacatt
gaacatacgttagcgcgtcgcggtgctgagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtagcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtaaaacgaatt
aatcaaacgcttcaacgtgcggaccaaattcagcatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggtgggcaattaaatgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggtggaaaagtactactaccaacgcaaacagca
gtacgcaatttaatttctgcacgccttgcagcagatgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacgaatgcaggtctt
gatcaagcaattgcgcgcggtttagcgtatgcaccgtacgcagacctcgtttggtgtgaa
acgtcagaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccagggaagctacttgcatataactgctcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcaagcttccaaaaggaaatcgcatcttacggttacaagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
catggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagta
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system