KEGG   Bacillus cereus B4264: BCB4264_A1182Help
Entry
BCB4264_A1182     CDS       T00805                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00630  Glyoxylate and dicarboxylate metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01200  Carbon metabolism
Module
bcb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCB4264_A1182 (aceA)
Enzymes [BR:bcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BCB4264_A1182 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACK62701
UniProt: B7HGN8
Position
1152392..1153669
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaagttgcaagaaagctgggaattagatgagcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcgggtcaattgacatt
gaacatacgttagcgcgtcgcggtgctgagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtagcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtaaaacgaatt
aatcaaacgcttcaacgtgcggaccaaattcagcatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggtgggcaattaaatgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggtggaaaagtactactaccaacgcaaacagca
gtacgcaatttaatttctgcacgccttgcagcagatgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacgaatgcaggtctt
gatcaagcaattgcgcgcggtttagcgtatgcaccgtacgcagacctcgtttggtgtgaa
acgtcagaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccagggaagctacttgcatataactgctcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcaagcttccaaaaggaaatcgcatcttacggttacaagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
catggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagta
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system