KEGG   Bacillus cereus B4264: BCB4264_A1207Help
Entry
BCB4264_A1207     CDS       T00805                                 

Gene name
asnO1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcb  Bacillus cereus B4264
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1173179..1175026
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDETNYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILSHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERLGKGQLHTYSIDYEDND
KYFKANAFQPNSDAPFINLMTETFQTTHHRCVISNEKLAEYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQRRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGVLPHDILYRKKSPYPKTHNP
HYTKAVTVWLQNLLTDKGSILHELFDKEQLSGLIQSGGSAFQTPWFGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaaagagatgtc
gttacgaagatggctgagacgttagcgaaacgggggccggatgataataaagtttggatt
aaaggaaatgtcgcatttgggcataagcggttaatcgttgtggatcctgagggcggtaaa
cagccgatgacttgtttaaaagatgaaacgaattacgccatttgctataacggtgaactt
tataacacagaagacattcgaaaggaattattaagaagaggatatacgttcaaaggtcat
tctgatacagaagtattattagcttcttatattgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgcagtatgggacgaacagaaagagcaagtatttattgcg
agagatcgattaggtgtaaagccacttttttataaatatgatagcggacgcttactattt
ggttcggagttaaaagcgatattgtcgcatccagatgtgaaggcggaagtaacgttagaa
ggattatcagaaatattcgggctcggaccgtcaagaacgcctggccacggtatttatgct
ggtataaaagaattgcgtccaggtcatgcgatgacattttcaaagaacggtttatgcata
tggagatattggaatgtagaaagtaaaaaacatgaagactcttttgaagaaacagtagag
aaaacgcgctttttattacaagatgctattacaagacagcttgtttctgatgtaccacta
tgtacttttttatcgggtggtgtagattcgagcgctattacagctattgcagcgaaagaa
tatgagagattgggaaaagggcaattacacacgtattctattgattacgaagataatgac
aaatactttaaagcgaatgcattccagccaaattcagatgctccgtttattaatttaatg
actgagacatttcaaacaacccatcatcgctgcgtcatttcgaatgaaaaattagcagag
tatttaactgaagcagtactcgttcgtgatttgcctggtatggcagatatcgattcgtca
ttattatggttttgccgagaaattaaacaagattttgtcgttggcttatctggagaatgt
gcagatgaaatatttggtggatatccgtggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaggcacgtgaacaacttctaaaaaaagaatggaga
aataaattaaatttacaacaatatgtacaaaggcgctatgaagagtcgattcaagaagtt
cctattttagagggggaaagtccgctagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgcatgagtatgggagcgagc
ttagaagtacgtgttccatttgcagatcatcgtcttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattacgtaaagcgttagaaggt
gtacttccacatgacatcttatatagaaagaagagtccttatccgaaaacgcacaatccg
cactatacaaaagcagtaacagtatggcttcaaaatctattaacggataaaggttcaatt
ttacacgaactgtttgataaagagcagttgagcggattaattcagtctggcggcagtgca
tttcaaacaccatggtttggtcaattgatgactgggccacagcttttagctcatttagca
caaattcacgtttggtttaaagaatatggggtaaatattaaggaataa

DBGET integrated database retrieval system