KEGG   Bacillus cereus B4264: BCB4264_A1257Help
Entry
BCB4264_A1257     CDS       T00805                                 

Definition
bis(5'-nucleosyl)-tetraphosphatase
Orthology
K01090  
protein phosphatase [EC:3.1.3.16]
Organism
bcb  Bacillus cereus B4264
Brite
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BCB4264_A1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1224370..1225110)
Genome map
AA seq 246 aa AA seqDB search
MKYDIIGDIHGCFQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIV
WELVIHKKEAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNIIKEKFIT
LYEQSPLYHILDEKRVIVCHAGIRQDYIGRRDKKVQTFVLYGDITGEKHADGSPVRRDWA
QEYKGQAWIVYGHTPVAEPRFINQTVNIDTGAVFGGKLTGLRYPEMETISVPSSLPFVAE
KFRPIS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgacattataggagatattcatggatgcttccaagagtttcaaaatttaaca
gagaagctaggatataactggagtagcggtctaccggttcaccctgaccaacgtaaactt
gcattcgttggcgatattacagaccgtggtcctcattcattacgtatgattgaaattgta
tgggaacttgtcatacataaaaaagaagcttattacgctcctggaaatcactgtaataaa
ctatatcgatttttccttgggcgtaatgtaacagtcgctcacggacttgaaacaactgtt
gctgaatatgaggcacttccttctcataagcaaaacattataaaagaaaagtttatcact
ctttatgaacaatcaccgctctaccacatactagatgaaaaaagagtaatcgtatgtcac
gctgggattcggcaagattacataggaagacgagataaaaaagtacaaacctttgtatta
tatggcgatattacaggagaaaagcatgccgatggctcacctgtccgtcgcgattgggcg
caagagtacaaggggcaagcttggattgtatatggacatacaccagtagcagaacctcga
ttcatcaatcagacagtcaatattgatactggtgctgtatttggtggcaaattaaccgga
ttacgttatcctgaaatggagactatctctgttccttcttctttaccttttgtcgctgaa
aaattccgtccaatttcataa

DBGET integrated database retrieval system