KEGG   Bacillus cereus B4264: BCB4264_A1294Help
Entry
BCB4264_A1294     CDS       T00805                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcb  Bacillus cereus B4264
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bcb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1255338..1256099
Genome map
AA seq 253 aa AA seqDB search
MGTILDEIVEQKQREVAELYEIYTPVKTKRKTHSLVEALQQFTVIAEVKRASPSKGDINL
HVDVRKQVGTYEKCGAGAVSVLTDGQFFKGSFHDLQTAREESNIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEVIVEVHDEQELETAIVLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SISSFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagatgaaattgtagaacagaagcaaagggaagttgcggagttgtat
gaaatatatacaccagtaaaaacaaaaagaaagacacattcacttgtagaagcgttacag
cagtttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgacgtacgaaaacaagtgggaacatatgagaaatgtggtgcaggagcagtatct
gttttaacagatggtcaattttttaaagggtcgtttcacgatttacaaacagcaagagaa
gaaagtaacattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcatatgaagcgggagcagatattattttactaattgtagcagcgttaacgaaagagaag
ttaaaagagttgtatagctacgtgttagaaaaaggattggaagtgattgttgaagttcat
gatgaacaggaattagaaactgcgattgtattaaatccgcacgttattggcattaataat
cgtaatttaaaaacgttcgaagtagatttaagccaaacggaaaagcttggaaaaagattg
aatgaggagaaactactttggattagtgaaagtggcattcattcaaaagaagatattatt
cgtgttaaaagagctggggccaaaggtgtattagttggagaggcgcttatgacatcatct
tctattagtagtttttttgaagattgtaaggtgaatatatga

DBGET integrated database retrieval system