KEGG   Bacillus cereus B4264: BCB4264_A1294Help
Entry
BCB4264_A1294     CDS       T00805                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01130  Biosynthesis of antibiotics
bcb01230  Biosynthesis of amino acids
Module
bcb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCB4264_A1294
Enzymes [BR:bcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCB4264_A1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth QRPTase_C pXO2-34
Motif
Other DBs
NCBI-ProteinID: ACK60144
UniProt: B7HGZ9
Position
1255338..1256099
Genome map
AA seq 253 aa AA seqDB search
MGTILDEIVEQKQREVAELYEIYTPVKTKRKTHSLVEALQQFTVIAEVKRASPSKGDINL
HVDVRKQVGTYEKCGAGAVSVLTDGQFFKGSFHDLQTAREESNIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEVIVEVHDEQELETAIVLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SISSFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagatgaaattgtagaacagaagcaaagggaagttgcggagttgtat
gaaatatatacaccagtaaaaacaaaaagaaagacacattcacttgtagaagcgttacag
cagtttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgacgtacgaaaacaagtgggaacatatgagaaatgtggtgcaggagcagtatct
gttttaacagatggtcaattttttaaagggtcgtttcacgatttacaaacagcaagagaa
gaaagtaacattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcatatgaagcgggagcagatattattttactaattgtagcagcgttaacgaaagagaag
ttaaaagagttgtatagctacgtgttagaaaaaggattggaagtgattgttgaagttcat
gatgaacaggaattagaaactgcgattgtattaaatccgcacgttattggcattaataat
cgtaatttaaaaacgttcgaagtagatttaagccaaacggaaaagcttggaaaaagattg
aatgaggagaaactactttggattagtgaaagtggcattcattcaaaagaagatattatt
cgtgttaaaagagctggggccaaaggtgtattagttggagaggcgcttatgacatcatct
tctattagtagtttttttgaagattgtaaggtgaatatatga

DBGET integrated database retrieval system