KEGG   Bacillus cereus B4264: BCB4264_A1567Help
Entry
BCB4264_A1567     CDS       T00805                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bcb  Bacillus cereus B4264
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496427..1496996
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcgatt
ggggatgacccaaatcgtgagggagtacttgatacaccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagagcatttgcataaagtattcgga
gaagatcacgaagagcttgtactagtaaaagatataccattttattcgatgtgtgagcat
catttagtaccattctatggagttgctcacgttgcatatattccgcaaggtggaaaggta
acagggttaagtaaattagctcgtaccgtagatacaattgcacgtcgcccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtactagagcctcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgtggtgtgaaaaaaccaggt
gcgaaaacagtaacgacagcagtgcgtggtgtgcttgaaaatgatgctgcagcgcgcagt
gaaattttatcgtttattaaaacgaagtaa

DBGET integrated database retrieval system