KEGG   Bacillus cereus B4264: BCB4264_A1761Help
Entry
BCB4264_A1761     CDS       T00805                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A1761
   01230 Biosynthesis of amino acids
    BCB4264_A1761
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A1761
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A1761
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCB4264_A1761
Enzymes [BR:bcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCB4264_A1761
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCB4264_A1761
  Exosomal proteins of melanoma cells
   BCB4264_A1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670291..1670866
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYKLSIQTEEDLRERLLSTEPVSNFNDAIENVWEDWSFAYEGGESNDIAQRRAVICM
QNILKQYEGKNIVIGTHGNIMVLLMNYFNSKYDFEFWKTLHMPDVYKLNFDKNRFISAER
IEKTGHRLNIL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggaa
cgacctttatctgaaaaagggcactgtgatgcagagaatgtaacacatttattaaaagat
aaacatattgatgttgttatttctagtccgtacaaaagagcaatccaaactgtacaagga
attgcgaatacatataaattatcaatacaaacagaagaagatttgcgtgaaagattattg
agcacagagccagtatcaaattttaatgatgctatcgagaatgtgtgggaggattggagt
tttgcatacgaaggcggagaatcgaatgatatcgcacaaaggcgcgctgtaatatgtatg
caaaatatattaaaacaatatgaaggtaagaatattgtaataggtacgcatggaaatatt
atggtattactcatgaattattttaattcgaaatatgattttgagttttggaaaacactt
catatgcctgatgtgtataaattaaattttgataaaaatcgtttcatttctgctgaaaga
atagagaaaacaggtcatcggttaaatattttgtaa

DBGET integrated database retrieval system