KEGG   Bacillus cereus B4264: BCB4264_A1767Help
Entry
BCB4264_A1767     CDS       T00805                                 

Gene name
asnO2
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcb  Bacillus cereus B4264
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCB4264_A1767 (asnO2)
Enzymes [BR:bcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCB4264_A1767 (asnO2)
Peptidases [BR:bcb01002]
 Cysteine Peptidases
  Family C44
   BCB4264_A1767 (asnO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1673954..1675777)
Genome map
AA seq 607 aa AA seqDB search
MCGITGWVDWKEDLSNQHVILKKMANSIEHRGPDAEGFWFSPHAAFAHRRLIVIDPEGGT
QPKTFRAGDYTYALTYNGEIYNFRELKEQLQKCGHAFETHSDTEVLLHAYLEWKEDCVRY
LNGIFAFALWDDQKQQLFLARDHLGVKPLFFTERNGSIIFGSEIKALLAHPSVPAELDAG
GINEIFGLGLFRTPGCGVFKHIQEVRAGHSITFTRHKKVVTKYWNLESKFHTDSIEDTSS
HILSILQDTVKRQLIADVPLVCMLSGGLDSSGITALAGKEFAAENKTLHTYSVDFVNSAK
DFELTFARTGLDAPWVKRVSEHVRTAHHDIIVNAEELANHLFVPLHAKDLPSAGEMETSL
YLLFCEMKKDATVALSGESADEVFGGYPWFHQEELLYVDKFPWLTNWKNTSPLLLNEVSN
QCNLENYIDTRFQEAILEVPTLEGESKKSAKQRQMFYLFLTRFLPFLLDRKDRMSMAVGF
EVRVPFCDYRLVEYLWNVPFNIKSIDNIEKGILRRALQPALPDDVRNRRKSAYPTSQDPH
YLQTIRNLTLDMCSNKNNPIFSLINHSILLSIADQSNKEINNFEARSAMEYMLQVNEWLK
TYHIHIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacaggttgggtagattggaaggaagacctttcaaatcaacatgttatt
ttaaaaaagatggcaaatagtattgagcatcgtggtccagatgctgaaggattttggttt
tcacctcatgcggcctttgcacaccggcgtttaattgtaattgatccagaaggcggtaca
cagccgaagacattccgtgctggtgattatacgtatgctcttacttataatggagaaatt
tataatttccgtgaacttaaagagcagcttcaaaaatgtgggcatgcatttgaaacccat
tcagatacagaagtgttactacatgcttatttagaatggaaagaagactgcgtgcgatat
ttaaacggaattttcgcttttgccttatgggatgatcagaagcaacaattatttttagcg
cgtgatcatttaggtgtaaaaccactcttttttacagaaagaaatggcagtattattttc
ggctctgaaattaaagcattattagcgcatccatctgtccctgctgaacttgatgcgggt
ggaataaatgaaatatttggattaggcttatttcgcactccaggatgtggcgtctttaaa
catattcaagaagtacgtgctggacattctataacatttacacgtcataaaaaagtagtt
acgaagtattggaatttagaaagtaagttccatacagactctatagaagatacatcttcg
catattttatctattttacaagatacagtaaaaagacaattaattgccgatgttcctctc
gtttgtatgttatcaggcggattagactctagcggtattactgcacttgctggtaaagaa
tttgctgctgaaaataaaacacttcatacgtattctgttgactttgtaaatagcgcaaaa
gatttcgaactgacatttgctcgcactggtttagacgcaccttgggtaaaacgcgtttct
gaacatgtcaggacagcgcatcatgatattattgtgaatgctgaagaattagcaaatcac
ttattcgttccccttcatgcaaaagatttaccgagtgctggtgaaatggaaacttcacta
tatttactattttgcgaaatgaaaaaagatgcgaccgtagctttatccggtgaatcggct
gatgaagtattcggtggatacccttggtttcatcaagaagaattactatatgtagataag
tttccttggctaacaaattggaaaaatacatctcctcttctactaaatgaagtaagtaac
caatgtaatctagaaaactatattgatacacgattccaagaagcgatacttgaagtacct
actcttgaaggggaaagtaaaaaatccgcgaaacaacgccaaatgttttatttattttta
acaagattccttcctttcttacttgaccgtaaagatcgtatgagtatggctgttggattt
gaagttcgtgtaccgttttgcgattatagattagttgaatatttatggaatgttcctttc
aacataaaaagtattgataatattgaaaaaggcattttacgtagagcactacaaccagct
ttacctgacgatgtacgtaatagaagaaaaagcgcttatccaacttcacaagatccacac
tacttacaaacaatccgtaatttaacacttgatatgtgtagtaataaaaacaatcctatt
ttctcacttattaaccattccatcttactttcaattgctgatcaaagtaataaagagatt
aacaattttgaggcaagaagtgccatggagtatatgctacaagtaaatgaatggttaaaa
acatatcatattcatattgcttaa

DBGET integrated database retrieval system