KEGG   Bacillus cereus B4264: BCB4264_A2442Help
Entry
BCB4264_A2442     CDS       T00805                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A2442 (gpmA)
   01230 Biosynthesis of amino acids
    BCB4264_A2442 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A2442 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A2442 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCB4264_A2442 (gpmA)
Enzymes [BR:bcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCB4264_A2442 (gpmA)
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCB4264_A2442 (gpmA)
  Exosomal proteins of melanoma cells
   BCB4264_A2442 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342718..2343455
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDMAYTSVLKR
AIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVR
PPALTEDDPRYEATDPRYKTLKKGEFPLTECLEDTEKRVLAYWHSEIAPTLKSGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagcttatggaatcttgaaaatcgcttt
actggatggacagatgttgatctatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaacggatatacttttgatatggcttatacatctgtattaaaacgc
gcaattcggacgttatggattgtacttcatgagatggatcttacttgggttccaatacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggctgaataaagatgaa
actgctcaaaaatatggtgaggagcaagttcatatttggagaagaagtgttgatgtaaga
ccaccggctcttactgaagacgatcctcgatatgaagcgaccgatccaagatataaaaca
ctcaaaaaaggtgaatttccattaactgaatgtttagaggatacggagaagagagtactt
gcttattggcattcagaaattgcgccgacattaaaaagtggtaataaagtaattatttca
tcacacggtaacacaattcgctcgctagtaaaatatttagacaacctttcaagtgatggt
gtagtttcattaaatattccaactagcattccgcttgtttatgaattagacgaaaactta
cgtccgattcgtcattattatttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system