KEGG   Bacillus cereus B4264: BCB4264_A2442Help
Entry
BCB4264_A2442     CDS       T00805                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A2442 (gpmA)
   01230 Biosynthesis of amino acids
    BCB4264_A2442 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A2442 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A2442 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCB4264_A2442 (gpmA)
Enzymes [BR:bcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCB4264_A2442 (gpmA)
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCB4264_A2442 (gpmA)
  Exosomal proteins of melanoma cells
   BCB4264_A2442 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342718..2343455
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDMAYTSVLKR
AIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVR
PPALTEDDPRYEATDPRYKTLKKGEFPLTECLEDTEKRVLAYWHSEIAPTLKSGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagcttatggaatcttgaaaatcgcttt
actggatggacagatgttgatctatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaacggatatacttttgatatggcttatacatctgtattaaaacgc
gcaattcggacgttatggattgtacttcatgagatggatcttacttgggttccaatacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggctgaataaagatgaa
actgctcaaaaatatggtgaggagcaagttcatatttggagaagaagtgttgatgtaaga
ccaccggctcttactgaagacgatcctcgatatgaagcgaccgatccaagatataaaaca
ctcaaaaaaggtgaatttccattaactgaatgtttagaggatacggagaagagagtactt
gcttattggcattcagaaattgcgccgacattaaaaagtggtaataaagtaattatttca
tcacacggtaacacaattcgctcgctagtaaaatatttagacaacctttcaagtgatggt
gtagtttcattaaatattccaactagcattccgcttgtttatgaattagacgaaaactta
cgtccgattcgtcattattatttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system