KEGG   Bacillus cereus B4264: BCB4264_A2783Help
Entry
BCB4264_A2783     CDS       T00805                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00020  Citrate cycle (TCA cycle)
bcb00620  Pyruvate metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
Module
bcb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A2783 (acoC)
   00020 Citrate cycle (TCA cycle)
    BCB4264_A2783 (acoC)
   00620 Pyruvate metabolism
    BCB4264_A2783 (acoC)
Enzymes [BR:bcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCB4264_A2783 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H FAM76
Motif
Other DBs
NCBI-ProteinID: ACK58863
UniProt: B7H9Z2
Position
complement(2682176..2683375)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEMQESTHVIEEKTFNIEVQTVQNQEPNGKEVAKQRIK
ISPVAKKIAKSENLDIKVLVGTGPGGRITKVDVLKALEVRGIVPEISEQEESNVIPVTGM
RKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAKVVQKRYDNKLTITDFVSRAAVL
ALGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLIVPAIRFANNLSLVELSKEIKNVAQ
KARAGSLSSDDMHGTTFTISNLGSFGIEYFTPVLNTPETGILGIGAIEHVPVYKGKKLKK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKHYLEEPITILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttaggtatggcgatgaaagaaggtattattacg
agctggaatattaaagcaggcgataatgtagcaaaaggagaactaattgctagtattaat
tcagaaaaaattgaaacggaaattgaagcgccagctgatggtacggtgcttgatatagct
gtaagtgaagatgaaggggtgccgcctggtactgtaatttgctacatcggtaaaccgaat
gaaaaagtagaaatgcaggaaagcacacatgtgatagaagaaaaaacatttaatatagaa
gtacaaactgtacaaaatcaagaaccaaatgggaaagaagtagccaagcaaagaattaaa
atttcacctgtagcgaagaaaattgcaaagtctgaaaatttggatatcaaggtattagtt
ggtacaggtcctggcggaaggattacaaaggtagatgtattaaaagcacttgaggtaaga
ggaatcgttccggaaatatctgaacaagaagaaagtaacgtgattcctgttactggtatg
cgtaaagcgatcgcaaatcgtatgcacgcaagcttacaaaatagcgcacaattaacgtta
acgatgaaagtagatgtaacagatttagttgctttacataaagaaatagcgaaagttgta
caaaaaagatatgataataaattaaccattacggatttcgtctcgcgtgctgctgtatta
gcacttggagagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaattt
gaacatgtgcatttaggcatggcagtcgcattagaaaaagggttaatcgttccagctatt
cgctttgcaaataatttatctttagtagaattgtctaaagagattaagaatgtggcacaa
aaggcgcgagcaggtagcttaagtagtgatgatatgcacggaacgacatttacaattagt
aatttaggtagctttggtattgaatatttcacacctgtattaaatacacctgagactggc
attttaggtattggcgcaattgaacatgttcctgtatataaagggaaaaaattaaaaaaa
ggtagtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcaccagca
gctgcatttttacgcacaattaaacattatttagaagaacctataacaattcttttataa

DBGET integrated database retrieval system