KEGG   Bacillus cereus B4264: BCB4264_A3231Help
Entry
BCB4264_A3231     CDS       T00805                                 

Gene name
cypD
Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bcb  Bacillus cereus B4264
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BCB4264_A3231 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BCB4264_A3231 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCB4264_A3231 (cypD)
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BCB4264_A3231 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BCB4264_A3231 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3117837..3120857)
Genome map
AA seq 1006 aa AA seqDB search
MVAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYH
AMMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITS
MTRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLS
RMLNVKDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVD
RVLTDPTPTYEQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRIS
VLIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVM
GMLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLAPTEDKLKNDEIK
QHVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVRTEVVALNDQIGSLPK
EGAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYI
DEQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKAFGLELNKNMEKERSTLSL
QFVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLP
VNSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQ
IREMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPA
LKPRYYSISSSPLVAHNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRT
PQSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNLGQAHLYFGCRHPEKDY
LYRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGS
KMAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
ttggtagcagaagtttgtgacgaaacacgtttcgataaaagtatagagggtgctttagca
aaagttcgtgcctttgctggagacggattatttactagcgagactcacgagcctaactgg
aaaaaagctcataatattttgatgcctacattcagccaacgggcaatgaaagattaccat
gccatgatggtcgatattgctgtacaactcgttcaaaaatgggcacggcttaatccgaat
gaaaacgtagatgttccggaggatatgactcgtcttacgttagatacaattggtctatgt
ggttttaattaccgattcaatagcttttatcgtgagacccctcatccttttattactagc
atgacccgtgctctagatgaggcgatgcaccaattacagaggctggatatagaagacaaa
ctcatgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttctttagta
gataatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcc
cgtatgttaaatgtgaaggatccggaaactggtgaaaaattagatgatgaaaatattcgt
tttcaaattattacctttttaatagctggacatgagacaacaagtggattgttatctttt
gcgatttactttttattaaagaatccggataagttgaaaaaagcctatgaagaagtagac
cgtgttttgacagatcctactccaacatacgaacaagttatgaaactgaagtatatacgg
atgattttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctctatgca
aaagaagatacagtgattggtgggaaatacccaattaagaaaggagaagatcgtatttct
gttcttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattc
caacctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttgga
aatggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatg
ggaatgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaa
caaacattaacgctaaagcccggtgattttaagattaggattctacctcgaaaacaaact
attagtcatcctactgttcttgcacctacagaggacaagctgaaaaacgatgaaattaag
cagcacgtccagaagacaccttctattattggggccgataatctttcacttcttgttctg
tatggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagt
ttagaaggagttcgaacggaagtggtagctcttaacgatcaaattggaagtttgccaaaa
gaaggagcggtacttattgtgacttcttcttataatggaaaaccgccaagtaatgcaggg
cagtttgtgcaatggttggaggaactaaaaccagatgagctaaaaggggttcaatacgca
gtttttggttgtggagatcataattgggctagtacctaccaacggattccaagatacatt
gatgagcagatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgca
agtggtgatttcgaggaacagctcgagcaatggaaacaaagcatgtggtctgatgcgatg
aaggcatttggattggaactaaacaaaaatatggaaaaagagcgcagtactttgagtctg
caatttgttagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtgtatgca
tctatactagaaaatcgtgaactccaatcatccagcagtgatagaagtacacgacatatc
gaggtatccttgccagaaggtgctacatataaagaaggagaccaccttggagtgttgcca
gttaatagcgagaaaaatatcaaccgaattttaaaacgttttggattaaatgggaaggat
caagttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgtt
agtttattggaccttcttagttatagtgttgaagttcaagaagcagccactcgagcacaa
atacgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcatta
ttagaagaaggagtttatcatgaacaaatattaaagaaacggatttcaatgttggacctt
cttgaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttctccctgcg
ctcaaaccgcgttactattctatttcaagctctccactcgttgcacacaatcgtctgagc
attacggtcggtgttgttaatgcacctgcatggagtggggaagggacatatgaaggagtc
gcttctaattacttagctcagcgtcataataaagatgagattatttgtttcattcgaacg
ccacaatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggcca
ggtactggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaa
ggtatgaacttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattat
ctttatcgtacagaactagaaaatgatgaaagagatggattaatctctttacacacagct
ttttctcgtttagagggacatccaaaaacatatgtacagcatttaataaaacaagataga
atcaatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagt
aaaatggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtc
agtgaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaa
gatgtttgggctggtatatga

DBGET integrated database retrieval system