KEGG   Bacillus cereus B4264: BCB4264_A3845Help
Entry
BCB4264_A3845     CDS       T00805                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcb  Bacillus cereus B4264
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCB4264_A3845
   01230 Biosynthesis of amino acids
    BCB4264_A3845
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A3845
  Energy metabolism
   00680 Methane metabolism
    BCB4264_A3845
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCB4264_A3845
Enzymes [BR:bcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCB4264_A3845
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCB4264_A3845
  Exosomal proteins of melanoma cells
   BCB4264_A3845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3753261..3753836)
Genome map
AA seq 191 aa AA seqDB search
MSTYIYMVRHGESPKLEGNERMRGLTERGHMDARRVTDILKAERIDTFISSPYNRAMLTI
EESANFHEKEIVVYENLKECMFSSEDQVISDKEVYPLVQKMFSNPDFARTKGESYADCQR
RVVKVLKEILLDFQGRKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEEQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatatatttatatggttagacatggtgaatcaccaaaactagaaggaaatgaa
agaatgcgcgggttaactgagaggggacatatggatgcccgtagagtaactgacatatta
aaagcggagaggattgatacttttatttccagtccttataatcgggctatgttaacgata
gaggagtcagctaatttccatgaaaaagaaatagtagtatatgaaaatcttaaagagtgt
atgttttcaagtgaggatcaggttatatcagacaaagaggtgtatccacttgtacagaag
atgttctctaatccagactttgcacgaacgaaaggagagtcatatgcagattgccagaga
agagtagtgaaagtattaaaagaaatcttattggattttcaaggacgcaaaattgtaatt
ggtacacatgggcttgtcatgacattaatgatgaactattttgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccggatatatataagatggaatttaaagaagaacaa
ttaatgaatgtagagagattatggaaagctgaataa

DBGET integrated database retrieval system