KEGG   Bacillus cereus B4264: BCB4264_A4148Help
Entry
BCB4264_A4148     CDS       T00805                                 

Definition
5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bcb  Bacillus cereus B4264
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bcb00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4055046..4055558
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSRFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAIF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
agatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattcgttaacagatgaaaacaaagctgaaatattagctattttt
tcaaaagaaatcgctgatgtttcagcacgccgtggttataaagcacatgatgtaatttca
ctttcaaatagcacccctaaccttgacgaattattaattaatttccaaaaggaacaccat
catacagatgacgaagttcgctttatcgtcagtggtcatggcattttcgctattgaaggt
aaagatgggaaattctttgatgttgaacttgagccaggcgatttaatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgccaagttgtagctattcgtattttt
gtgacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system