KEGG   Bacillus cereus B4264: BCB4264_A4148Help
Entry
BCB4264_A4148     CDS       T00805                                 

Definition
(GenBank) putative 5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00270  Cysteine and methionine metabolism
bcb01100  Metabolic pathways
Module
bcb_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCB4264_A4148
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BCB4264_A4148
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BCB4264_A4148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_3 SF-assemblin DUF3047
Motif
Other DBs
NCBI-ProteinID: ACK63921
UniProt: B7H930
Position
4055046..4055558
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSRFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAIF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
agatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattcgttaacagatgaaaacaaagctgaaatattagctattttt
tcaaaagaaatcgctgatgtttcagcacgccgtggttataaagcacatgatgtaatttca
ctttcaaatagcacccctaaccttgacgaattattaattaatttccaaaaggaacaccat
catacagatgacgaagttcgctttatcgtcagtggtcatggcattttcgctattgaaggt
aaagatgggaaattctttgatgttgaacttgagccaggcgatttaatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgccaagttgtagctattcgtattttt
gtgacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system