KEGG   Bacillus cereus B4264: BCB4264_A4514Help
Entry
BCB4264_A4514     CDS       T00805                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcb  Bacillus cereus B4264
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCB4264_A4514
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCB4264_A4514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4369388..4371724)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYMVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNKK
DRSFISCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtatgacgaaaagaaagtaatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacattgacaggtcattttaaggaccatccaaagtatgga
aaacaatatatggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagctgaaaaaattgtg
gaccatctcggagaacatgctatttctaaaattatggatgaccctgaggcattaaatggt
gttgttaataaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagctttttaaatggctacggttttggaacgaagctttctattaaaatt
tatcagcaatataaagagatgacattagaagtgattcgtaataatccgtatcaacttatt
gaagaagtggacgggattggttttggaagagcggatgatatagggcgtgcgttagggata
tcgggtaatcatgacgaccgtgtacgcgcaggatgtttttacacattagagaatgtctca
ttacaacttggtcatgtttatatgaggaaagatcaacttgtaagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtgactgaggaagatattataggttgtattgaaacgatg
caaagtgaagggaaagtcatcatagaagaagaacgagtgtatttagcaacattattctac
tctgaaaaaggtgttgtaaagtctattcgcaggcttatgaatcaagaagaaacaccttca
tttccagaagcggaagtgttaaaaacgttaggtgaaattgaagaacaactgaacgtacaa
tatgcaccgtttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattg
acaggtggaccaggaacagggaaaacaacagttattaaagggattgttgaaatgtatgcg
tcacttcacggattatcgttaaatccgaatgaatacagtgatgataatccatttccaata
ctattaacagctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttcca
gcttgcacaattcaccgtttacttggttggacgccagaaggatctttccagcgtaatgaa
acggatcctgtccaaggtaagctccttattatcgatgaattttcaatggttgatatttgg
cttgcaaatcagctatttaagtcgttgccaacgaatattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggc
gcagttccgacagtgaagcttactgaaatttatcgtcaagcggaaggctcatcagtgatt
caacttgcccatgcgataaaaaatggaacgctaccaccagatttagcgcaaaacaaaaaa
gatcgttcgtttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgc
gaaaatgctaaaacaaaaggctttagcgcaagagatgtacaagtattagcaccgatgtac
cgcgggcctgctggtattaatgtattaaacgaagcgctgcaacaagtatttaatccgaag
agggaaaagagtaaagaaattgcttacggtgatgttgtgtaccgaagaggcgataaagta
ctgcaactcgtgaatcagccggagagccaagtgtttaatggtgatattggggaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacgtatacgaagcccgatttaaatcaaattacgcatgcatattgttgt
tccattcataaatcacaaggtagtgaatttccgattgttattatgccaatcgtgaaaagt
tacaaccgtatgttacgtcgtaatttaatttacacgggcattacaagaagtaagaagttc
cttattatttgcggagaggaagcagctttccaatctggtgtaaatcgccttgatgatgca
atgcgtcaaacaaccttagctagtcgcttgcaagaatcacaaggagaagtacagatggtc
acagttaatggcgaggaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system